CaMPDB :: Substrate

XSB1678 : myelin basic protein isoform 1 [Homo sapiens]

This entry is computationally expanded from SB0045

* Basic Information

Organism	Homo sapiens (human)
Protein Names	Myelin basic protein; MBP; Myelin A1 protein; Myelin membrane encephalitogenic protein; myelin basic protein isoform 1
Gene Names	MBP; myelin basic protein
Gene Locus	18q23; chromosome 18
GO Function	Not available

Entrez Protein	Entrez Nucleotide	Entrez Gene	UniProt	OMIM	HGNC	HPRD	KEGG
NP_001020252	NM_001025081	4155	P02686	159430	6925	N/A	hsa:4155

* Information From OMIM

Not Available.

* Structure Information

1. Primary Information

Length: 197 aa

Average Mass: 21.493 kDa

Monoisotopic Mass: 21.480 kDa

2. Domain Information

Annotated Domains: interpro / pfam / smart / prosite

Computationally Assigned Domains (Pfam+HMMER):

domain name	begin	end	score	e-value
Myelin_MBP 1.	17	196	313.9	3.4e-91
--- cleavage 125 (inside Myelin_MBP 17..196) ---

3. Sequence Information

Fasta Sequence: XSB1678.fasta

Amino Acid Sequence and Secondary Structures (PsiPred):

4. 3D Information

Known Structures in PDB: 1BX2 (X-ray; 260 A; C/F=217-231), 1FV1 (X-ray; 190 A; C/F=218-237), 1HQR (X-ray; 320 A; C=221-233), 1QCL (Model; -; A=135-304), 1YMM (X-ray; 350 A; C=217-231), 1ZGL (X-ray; 280 A; C/F/I/L=221-233)

* Cleavage Information

1 [sites]

Cleavage sites (±10aa)

[Site 1] FFKNIVTPRT¹²⁵-PPPSQGKGRG

Thr¹²⁵ Pro

P10	P9	P8	P7	P6	P5	P4	P3	P2	P1

Phe¹¹⁶	Phe¹¹⁷	Lys¹¹⁸	Asn¹¹⁹	Ile¹²⁰	Val¹²¹	Thr¹²²	Pro¹²³	Arg¹²⁴	Thr¹²⁵

P1'	P2'	P3'	P4'	P5'	P6'	P7'	P8'	P9'	P10'
Pro¹²⁶	Pro¹²⁷	Pro¹²⁸	Ser¹²⁹	Gln¹³⁰	Gly¹³¹	Lys¹³²	Gly¹³³	Arg¹³⁴	Gly¹³⁵

Sequence conservation (by blast) Sequence conservation (by blast)

Reference peptide (cleaved bond±30 residues)
YGSLPQKSHGRTQDENPVVHFFKNIVTPRTPPPSQGKGRGLSLSRFSWGAEGQRPGFGYG

Summary

#	organism	max score	hits	top seq
1	N/A	132.00	21	-
2	Pan troglodytes	132.00	18	PREDICTED: Golli-mbp isoform 16
3	Homo sapiens	132.00	12	myelin basic protein isoform 1
4	Human Golli-mbp gene, complete cds.	132.00	6	PREDICTED: similar to
5	Pongo pygmaeus	132.00	3	hypothetical protein
6	synthetic construct	132.00	2	myelin basic protein
7	Macaca mulatta	131.00	2	PREDICTED: similar to myelin basic protein isoform
8	Mus musculus	127.00	8	myelin basic protein isoform 1
9	Canis familiaris	124.00	1	PREDICTED: similar to Myelin basic protein (MBP) (
10	Bos taurus	123.00	2	PREDICTED: myelin basic protein
11	Sus scrofa	123.00	1	myelin basic protein
12	Rattus norvegicus	121.00	9	myelin basic protein isoform 1
13	Cavia porcellus	120.00	1	myelin basic protein; MBP
14	Monodelphis domestica	114.00	1	PREDICTED: similar to myelin basic protein,
15	Gallus gallus	101.00	1	myelin basic protein
16	Macaca fascicularis	100.00	2	unnamed protein product
17	Xenopus laevis	87.00	2	hypothetical protein LOC734401
18	Gekko japonicus	84.30	1	GekBS065P
19	Heterodontus francisci	52.40	1	MBP_HETFR Myelin basic protein (MBP) emb
20	cattle, brain, Peptide Partial, 17 aa, segment 3 of 3	38.10	1	clathrin assembly protein=myelin basic protein (MB
21	Danio rerio	32.70	2	Mbp protein

Top-ranked sequences

organism	matching
N/A	Query 96 YGSLPQKSHGRTQDENPVVHFFKNIVTPRT#PPPSQGKGRGLSLSRFSWGAEGQRPGFGYG 155 \|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|#\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\| Query 96 YGSLPQKSHGRTQDENPVVHFFKNIVTPRT#PPPSQGKGRGLSLSRFSWGAEGQRPGFGYG 155
Pan troglodytes	Query 96 YGSLPQKSHGRTQDENPVVHFFKNIVTPRT#PPPSQGKGRGLSLSRFSWGAEGQRPGFGYG 155 \|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|#\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\| Query 96 YGSLPQKSHGRTQDENPVVHFFKNIVTPRT#PPPSQGKGRGLSLSRFSWGAEGQRPGFGYG 155
Homo sapiens	Query 96 YGSLPQKSHGRTQDENPVVHFFKNIVTPRT#PPPSQGKGRGLSLSRFSWGAEGQRPGFGYG 155 \|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|#\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\| Query 96 YGSLPQKSHGRTQDENPVVHFFKNIVTPRT#PPPSQGKGRGLSLSRFSWGAEGQRPGFGYG 155
Human Golli-mbp gene, complete cds.	Query 96 YGSLPQKSHGRTQDENPVVHFFKNIVTPRT#PPPSQGKGRGLSLSRFSWGAEGQRPGFGYG 155 \|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|#\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\| Query 96 YGSLPQKSHGRTQDENPVVHFFKNIVTPRT#PPPSQGKGRGLSLSRFSWGAEGQRPGFGYG 155
Pongo pygmaeus	Query 96 YGSLPQKSHGRTQDENPVVHFFKNIVTPRT#PPPSQGKGRGLSLSRFSWGAEGQRPGFGYG 155 \|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|#\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\| Query 96 YGSLPQKSHGRTQDENPVVHFFKNIVTPRT#PPPSQGKGRGLSLSRFSWGAEGQRPGFGYG 155
synthetic construct	Query 96 YGSLPQKSHGRTQDENPVVHFFKNIVTPRT#PPPSQGKGRGLSLSRFSWGAEGQRPGFGYG 155 \|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|#\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\| Query 96 YGSLPQKSHGRTQDENPVVHFFKNIVTPRT#PPPSQGKGRGLSLSRFSWGAEGQRPGFGYG 155
Macaca mulatta	Query 96 YGSLPQKSHGRTQDENPVVHFFKNIVTPRT#PPPSQGKGRGLSLSRFSWGAEGQRPGFGYG 155 \|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|#\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|+\|\|\|\|\|\| Sbjct 200 YGSLPQKSHGRTQDENPVVHFFKNIVTPRT#PPPSQGKGRGLSLSRFSWGAEGQKPGFGYG 259
Mus musculus	Query 96 YGSLPQKS-HGRTQDENPVVHFFKNIVTPRT#PPPSQGKGRGLSLSRFSWGAEGQRPGFGY 154 \|\|\|\|\|\|\|\| \|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|#\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|+\|\|\|\|\| Sbjct 92 YGSLPQKSQHGRTQDENPVVHFFKNIVTPRT#PPPSQGKGRGLSLSRFSWGAEGQKPGFGY 151 Query 155 G 155 \| Query 155 G 155
Canis familiaris	Query 96 YGSLPQKS-HGRTQDENPVVHFFKNIVTPRT#PPPSQGKGRGLSLSRFSWGAEGQRPGFGY 154 \|\|\|\|\|\|\|\| \|\|\| \|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|#\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|+\|\|\|\|\| Sbjct 70 YGSLPQKSQHGRPQDENPVVHFFKNIVTPRT#PPPSQGKGRGLSLSRFSWGAEGQKPGFGY 129 Query 155 G 155 \| Query 155 G 155
Bos taurus	Query 96 YGSLPQKS-HGRTQDENPVVHFFKNIVTPRT#PPPSQGKGRGLSLSRFSWGAEGQRPGFGY 154 \|\|\|\|\|\|\|+ \|\|\| \|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|#\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|+\|\|\|\|\| Sbjct 432 YGSLPQKAQHGRPQDENPVVHFFKNIVTPRT#PPPSQGKGRGLSLSRFSWGAEGQKPGFGY 491 Query 155 G 155 \| Query 155 G 155
Sus scrofa	Query 96 YGSLPQKS-HGRTQDENPVVHFFKNIVTPRT#PPPSQGKGRGLSLSRFSWGAEGQRPGFGY 154 \|\|\|\|\|\|\|+ \|\|\| \|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|#\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|+\|\|\|\|\| Sbjct 70 YGSLPQKAQHGRPQDENPVVHFFKNIVTPRT#PPPSQGKGRGLSLSRFSWGAEGQKPGFGY 129 Query 155 G 155 \| Query 155 G 155
Rattus norvegicus	Query 96 YGSLPQKSHGRTQDENPVVHFFKNIVTPRT#PPPSQGKGRGLSLSRFSWGAEGQRPGFGYG 155 \|\|\|\|\|\|\|\| \|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|#\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|+\|\|\|\|\|\| Sbjct 94 YGSLPQKSQ-RTQDENPVVHFFKNIVTPRT#PPPSQGKGRGLSLSRFSWGAEGQKPGFGYG 152
Cavia porcellus	Query 96 YGSLPQKSHGRTQDENPVVHFFKNIVTPRT#PPPSQGKGRGLSLSRFSWGAEGQRPGFGYG 155 \|\|\|\|\|\|\|\| \|+\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|#\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|+\|\|\|\|\|\| Sbjct 63 YGSLPQKSQ-RSQDENPVVHFFKNIVTPRT#PPPSQGKGRGLSLSRFSWGAEGQKPGFGYG 121
Monodelphis domestica	Query 96 YGSLPQKS-HGRTQDENPVVHFFKNIVTPRT#PPPSQGKGRGLSLSRFSWGAEGQRPGFGY 154 \|\|\|\|\|\|\|\| \|\|\|\| \|+\|\|\|\|\|\|\|\|\|\|\|+\|\|\|#\|\| \|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|+\|\| \|\| Sbjct 210 YGSLPQKSQHGRTYDDNPVVHFFKNIVSPRT#PPAGQGKGRGLSLSRFSWGAEGQKPGCGY 269 Query 155 G 155 \| Query 155 G 155
Gallus gallus	Query 97 GSLPQKS-HGRTQDENPVVHFFKNIVTPRT#PPPSQGKGRGLSLSRFSWGAEGQRPGFGYG 155 \|\|+\|\|+\| \|\|\| \|+\|\|\|\|\|\|\|\|\|\|\|+\|\|\|#\|\|\| \| \|\|\|\|\|\|\|+\|\|\|\|\| \|\| +\|\|+\| \| Sbjct 68 GSIPQRSQHGRPGDDNPVVHFFKNIVSPRT#PPPMQAKGRGLSLTRFSWGGEGHKPGYGSG 127
Macaca fascicularis	Query 96 YGSLPQKSHGRTQDENPVVHFFKNIVTPRT#PPPSQGKGRGLSLSRFSWGAEGQRPGFGYG 155 \|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|#\|\|\|\|\|\|\| \|\|\|\|\|+\|\|\|\|\|\| Sbjct 70 YGSLPQKSHGRTQDENPVVHFFKNIVTPRT#PPPSQGK-----------GAEGQKPGFGYG 118
Xenopus laevis	Query 98 SLPQKSH----GRTQDENPVVHFFKNIVTPRT#PPPSQGKGRGLSLSRFSWGAEGQRPGF- 152 \| \|\|+\|\| \|\| \|\|\|\|\|\|\|\|\|+\|\|\|+\|\|\|#\|\|\|\|\| \| \|\|\|\|\|+\|\|\|\|\|\|+\| \|\| + Sbjct 72 SSPQRSHYYAHGRHVDENPVVHFFRNIVSPRT#PPPSQPK-RGLSLARFSWGADGHRPCYG 130 Query 153 GYG 155 \|\|\| Query 153 GYG 155
Gekko japonicus	Query 104 HGRTQDENPVVHFFKNIVTPRT#PPPSQGKGRGLSLSRFSWGAEGQRPGFGYG 155 +\|\| \|+\|\|\|\|\|\|\|\|\|\|\|+\|\|\|#\|\|\| \| \|\|\|\|\|\| \|\|\|\|\|\| \| + \|+\| \| Sbjct 80 YGRYVDDNPVVHFFKNIVSPRT#PPPMQAKGRGLSFSRFSWGGETPKHGYGSG 131
Heterodontus francisci	Query 105 GRTQDENPVVHFFKNIVTPRT#PPPSQGKGRGLS--LSRFSWGAEGQRPGFG 153 \|\| \|++ \|\|\|\|\|\|\|+++\|+ # \| \| \| \| +++\| \|\| +\|\|\|\| +\| Sbjct 67 GRQTDDSAVVHFFKNMMSPKK#APVQQKARSGASRAITKFIWGTDGQRPHYG 117
cattle, brain, Peptide Partial, 17 aa, segment 3 of 3	Query 141 FSWGAEGQRPGFGYG 155 \|\|\|\|\|\|\|\|+\|\|\|\|\|\| Sbjct 1 FSWGAEGQKPGFGYG 15
Danio rerio	Query 98 SLPQKSHG----RTQDENPVVHFFKNIV-TPRT#PPPSQGKGRGLS 137 \| \|\|+ \| \| \| \|\|\|\|\|\|\|++ \| +\|\| # \| \|+\|+ \| \| Sbjct 49 SSPQRPHHSSTRRRGDVNPVVHFFRSFVSSPR-#-PKSRGESRSRS 91

* References

[PubMed ID: 19372141] Lee JY, Park AK, Lee KM, Park SK, Han S, Han W, Noh DY, Yoo KY, Kim H, Welch R, Chanock SJ, Rothman N, Kang D, Candidate gene approach evaluates association between innate immunity genes and breast cancer risk in Korean women. Carcinogenesis. 2009 Apr 16.

» More (12) « Hide Below

[PubMed ID: 19034380] ... Martins-de-Souza D, Gattaz WF, Schmitt A, Rewerts C, Marangoni S, Novello JC, Maccarrone G, Turck CW, Dias-Neto E, Alterations in oligodendrocyte proteins, calcium homeostasis and new potential markers in schizophrenia anterior temporal lobe are revealed by shotgun proteome analysis. J Neural Transm. 2009 Mar;116(3):275-89. Epub 2008 Nov 26.

[PubMed ID: 19154657] ... Baruch K, Silberberg G, Aviv A, Shamir E, Bening-Abu-Shach U, Baruch Y, Darvasi A, Navon R, Association between golli-MBP and schizophrenia in the Jewish Ashkenazi population: are regulatory regions involved? Int J Neuropsychopharmacol. 2009 Jan 21:1-10.

[PubMed ID: 19053745] ... Deraos G, Chatzantoni K, Matsoukas MT, Tselios T, Deraos S, Katsara M, Papathanasopoulos P, Vynios D, Apostolopoulos V, Mouzaki A, Matsoukas J, Citrullination of linear and cyclic altered peptide ligands from myelin basic protein (MBP(87-99)) epitope elicits a Th1 polarized response by T cells isolated from multiple sclerosis patients: implications in triggering disease. J Med Chem. 2008 Dec 25;51(24):7834-42.

[PubMed ID: 19110265] ... Martins-de-Souza D, Gattaz WF, Schmitt A, Maccarrone G, Hunyadi-Gulyas E, Eberlin MN, Souza GH, Marangoni S, Novello JC, Turck CW, Dias-Neto E, Proteomic analysis of dorsolateral prefrontal cortex indicates the involvement of cytoskeleton, oligodendrocyte, energy metabolism and new potential markers in schizophrenia. J Psychiatr Res. 2008 Dec 23.

[PubMed ID: 1689270] ... Boylan KB, Ayres TM, Popko B, Takahashi N, Hood LE, Prusiner SB, Repetitive DNA (TGGA)n 5' to the human myelin basic protein gene: a new form of oligonucleotide repetitive sequence showing length polymorphism. Genomics. 1990 Jan;6(1):16-22.

[PubMed ID: 2449425] ... Shoji S, Ohnishi J, Funakoshi T, Fukunaga K, Miyamoto E, Ueki H, Kubota Y, Phosphorylation sites of bovine brain myelin basic protein phosphorylated with Ca2+-calmodulin-dependent protein kinase from rat brain. J Biochem. 1987 Nov;102(5):1113-20.

[PubMed ID: 2426402] ... Scoble HA, Whitaker JN, Biemann K, Analysis of the primary sequence of human myelin basic protein peptides 1-44 and 90-170 by fast atom bombardment mass spectrometry. J Neurochem. 1986 Aug;47(2):614-6.

[PubMed ID: 2425357] ... Kamholz J, de Ferra F, Puckett C, Lazzarini R, Identification of three forms of human myelin basic protein by cDNA cloning. Proc Natl Acad Sci U S A. 1986 Jul;83(13):4962-6.

[PubMed ID: 2413024] ... Kishimoto A, Nishiyama K, Nakanishi H, Uratsuji Y, Nomura H, Takeyama Y, Nishizuka Y, Studies on the phosphorylation of myelin basic protein by protein kinase C and adenosine 3':5'-monophosphate-dependent protein kinase. J Biol Chem. 1985 Oct 15;260(23):12492-9.

[PubMed ID: 2414074] ... Saxe DF, Takahashi N, Hood L, Simon MI, Localization of the human myelin basic protein gene (MBP) to region 18q22----qter by in situ hybridization. Cytogenet Cell Genet. 1985;39(4):246-9.

[PubMed ID: 4924231] ... Baldwin GS, Carnegie PR, Specific enzymic methylation of an arginine in the experimental allergic encephalomyelitis protein from human myelin. Science. 1971 Feb 12;171(971):579-81.