CaMPDB :: Substrate

XSB1836 : alpha-spectrin 2 [Rattus norvegicus]

This entry is computationally expanded from SB0061

* Basic Information

Organism	Rattus norvegicus (Norway rat)
Protein Names	Spectrin alpha chain, brain; Spectrin, non-erythroid alpha chain; Alpha-II spectrin; Fodrin alpha chain; alpha-spectrin 2; inhibitory protein factor; alpha-fodrin; nonerythroid alpha-spectrin 2; a--fodrin; brain alpha-spectrin; noerythroid alpha-spectrin 2
Gene Names	Spna2; Spna2, Spta2; Spta2; alpha-spectrin 2
Gene Locus	3p12; chromosome 3
GO Function	Not available

Entrez Protein	Entrez Nucleotide	Entrez Gene	UniProt	OMIM	HGNC	HPRD	KEGG
NP_741984	NM_171983	64159	P16086	N/A	N/A	N/A	rno:64159

* Information From OMIM

Not Available.

* Structure Information

1. Primary Information

Length: 2472 aa

Average Mass: 284.595 kDa

Monoisotopic Mass: 284.420 kDa

2. Domain Information

Annotated Domains: interpro / pfam / smart / prosite

Computationally Assigned Domains (Pfam+HMMER):

domain name	begin	end	score	e-value
Spectrin 1.	44	147	126.7	7.3e-35
Spectrin 2.	149	253	139.6	9.5e-39
Spectrin 3.	255	359	135.9	1.3e-37
Spectrin 4.	361	465	116.2	1.1e-31
Spectrin 5.	467	571	127.2	5.4e-35
Spectrin 6.	573	676	126.3	1e-34
Spectrin 7.	678	782	146.3	9.3e-41
Spectrin 8.	784	888	155.6	1.5e-43
SH3_1 1.	970	1024	78.9	1.8e-20
Spectrin 9.	1091	1231	71.0	4.4e-18
--- cleavage 1176 (inside Spectrin 1091..1231) ---
Spectrin 10.	1233	1337	147.8	3.4e-41
Spectrin 11.	1339	1442	115.6	1.6e-31
Spectrin 12.	1445	1549	120.2	6.7e-33
Spectrin 13.	1551	1656	100.8	4.6e-27
Spectrin 14.	1658	1762	132.2	1.6e-36
Spectrin 15.	1764	1868	149.9	7.8e-42
Spectrin 16.	1870	1974	127.1	5.5e-35
Spectrin 17.	1976	2081	117.1	6e-32
Spectrin 18.	2091	2195	72.2	1.9e-18
Spectrin 19.	2205	2310	64.9	3e-16
efhand 1.	2327	2355	36.5	1e-07
efhand 2.	2370	2398	23.4	0.00096
efhand_Ca_insen 1.	2402	2471	44.6	3.8e-10

3. Sequence Information

Fasta Sequence: XSB1836.fasta

Amino Acid Sequence and Secondary Structures (PsiPred):

4. 3D Information

Not Available.

* Cleavage Information

1 [sites]

Cleavage sites (±10aa)

[Site 1] VQAVQQQEVY¹¹⁷⁶-GMMPRDEADS

Tyr¹¹⁷⁶ Gly

P10	P9	P8	P7	P6	P5	P4	P3	P2	P1

Val¹¹⁶⁷	Gln¹¹⁶⁸	Ala¹¹⁶⁹	Val¹¹⁷⁰	Gln¹¹⁷¹	Gln¹¹⁷²	Gln¹¹⁷³	Glu¹¹⁷⁴	Val¹¹⁷⁵	Tyr¹¹⁷⁶

P1'	P2'	P3'	P4'	P5'	P6'	P7'	P8'	P9'	P10'
Gly¹¹⁷⁷	Met¹¹⁷⁸	Met¹¹⁷⁹	Pro¹¹⁸⁰	Arg¹¹⁸¹	Asp¹¹⁸²	Glu¹¹⁸³	Ala¹¹⁸⁴	Asp¹¹⁸⁵	Ser¹¹⁸⁶

Sequence conservation (by blast) Sequence conservation (by blast)

Reference peptide (cleaved bond±30 residues)
LKDINKVAEDLESEGLMAEEVQAVQQQEVYGMMPRDEADSKTASPWKSARLMVHTVATFN

Summary

#	organism	max score	hits	top seq
1	N/A	95.10	4	S
2	Rattus norvegicus	95.10	3	SPTA2_RAT Spectrin alpha chain, brain (Spectrin, n
3	Homo sapiens	93.60	16	SPTA2_HUMAN Spectrin alpha chain, brain (Spectrin,
4	Mus musculus	92.80	19	PREDICTED: similar to Spectrin alpha chain, brain
5	Monodelphis domestica	92.40	2	PREDICTED: similar to spectrin alpha 2 isoform 2
6	Canis familiaris	92.40	1	PREDICTED: similar to Spectrin alpha chain, brain
7	Bos taurus	91.70	2	PREDICTED: similar to SPTAN1 protein isoform 2
8	Gallus gallus	89.40	3	spectrin, alpha, non-erythrocytic 1 (alpha-fodrin)
9	Xenopus tropicalis	68.20	1	hypothetical protein LOC100036647
10	Tetraodon nigroviridis	59.70	2	unnamed protein product
11	Danio rerio	58.90	1	alpha II-spectrin

Top-ranked sequences

organism	matching
N/A	Query 1147 LKDINKVAEDLESEGLMXXXXXXXXXXXXY#GMMPRDEADSKTASPWKSARLMVHTVATFN 1206 \|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\| \|#\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\| Sbjct 93 LKDINKVAEDLESEGLMAEEVQAVQQQEVY#GMMPRDEADSKTASPWKSARLMVHTVATFN 152
Rattus norvegicus	Query 1147 LKDINKVAEDLESEGLMXXXXXXXXXXXXY#GMMPRDEADSKTASPWKSARLMVHTVATFN 1206 \|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\| \|#\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\| Sbjct 1147 LKDINKVAEDLESEGLMAEEVQAVQQQEVY#GMMPRDEADSKTASPWKSARLMVHTVATFN 1206
Homo sapiens	Query 1147 LKDINKVAEDLESEGLMXXXXXXXXXXXXY#GMMPRDEADSKTASPWKSARLMVHTVATFN 1206 \|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\| \|#\|\|\|\|\|\|\| \|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\| Sbjct 1147 LKDINKVAEDLESEGLMAEEVQAVQQQEVY#GMMPRDETDSKTASPWKSARLMVHTVATFN 1206
Mus musculus	Query 1147 LKDINKVAEDLESEGLMXXXXXXXXXXXXY#GMMPRDEADSKTASPWKSARLMVHTVATFN 1206 \|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\| \|#\| \|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\| Sbjct 1147 LKDINKVAEDLESEGLMAEEVQAVQQQEVY#GAMPRDEADSKTASPWKSARLMVHTVATFN 1206
Monodelphis domestica	Query 1147 LKDINKVAEDLESEGLMXXXXXXXXXXXXY#GMMPRDEADSKTASPWKSARLMVHTVATFN 1206 \|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\| \|#\|\|\|\|\|\|+ \|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\| Sbjct 1147 LKDINKVAEDLESEGLMAEEVQAVQQQEVY#GMMPRDDTDSKTASPWKSARLMVHTVATFN 1206
Canis familiaris	Query 1147 LKDINKVAEDLESEGLMXXXXXXXXXXXXY#GMMPRDEADSKTASPWKSARLMVHTVATFN 1206 \|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\| \|#\|\|\|\|\|\|+ \|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\| Sbjct 1243 LKDINKVAEDLESEGLMAEEVQAVQQQEVY#GMMPRDDTDSKTASPWKSARLMVHTVATFN 1302
Bos taurus	Query 1147 LKDINKVAEDLESEGLMXXXXXXXXXXXXY#GMMPRDEADSKTASPWKSARLMVHTVATFN 1206 \|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\| \|#\| \|\|\|\|\|+\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\| Sbjct 1147 LKDINKVAEDLESEGLMAEEVQAVQQQEVY#GAMPRDESDSKTASPWKSARLMVHTVATFN 1206
Gallus gallus	Query 1147 LKDINKVAEDLESEGLMXXXXXXXXXXXXY#GMMPRDEADSKTASPWKSARLMVHTVATFN 1206 \|\|\|\|\|\|\|\| \|\|\|\|\|\|\|\| \|#\|\|\|\|\|\|\| \|\|\|\| \|\|\|\|\|\|\|+\|\|\|\|\|\|\|\|\| Sbjct 1147 LKDINKVANDLESEGLMAEEVQAVEHQEVY#GMMPRDETDSKTVSPWKSARMMVHTVATFN 1206
Xenopus tropicalis	Query 1147 LKDINKVAEDLESEGLMXXXXXXXXXXXXY#GMMPRDEADSKTASPWKSARLMVHTVATFN 1206 \|\|\|\|\|\|\|\|++\|\|\|\|\|\|+ \|#\|\| \|\|\|\|\|\|\|+\|\|\|\|\|\| \| \| \|\|\|\|\| Sbjct 1147 LKDINKVADELESEGLITEEVQPVQHQEVY#GMQ-RDEADSKSASPWKSVRTAVLAVATFN 1205
Tetraodon nigroviridis	Query 1147 LKDINKVAEDLESEGLMXXXXXXXXXXXXY#GMMP----RDEADSKTASPWKSARLMVHTV 1202 \|+\|\|\|\|\|\| +\|\|\|\|\|\|\| # ++ +\|\|\|\|\|\|\|\|\|\|\|\|+ \|\| \| \| Sbjct 1267 LRDINKVAAELESEGLMAEETPMVQAQQQQ#ELLGAAPGKDEADSKTASPWKNVRLAVQTT 1326 Query 1203 ATFN 1206 \| \|\| Sbjct 1327 ANFN 1330
Danio rerio	Query 1147 LKDINKVAEDLESEGLMXXXXXXXXXXXX--Y#GMMP-RDEADSKTASPWKSARLMVHTVA 1203 \|+\|\|\|\|\|\| +\|\|\|\|\|\|\| #\| \| +\|\|\|\|\|\| \|\|\|\|\|\| \|\| \| \| \| Sbjct 1147 LRDINKVASELESEGLMAEEAPVVQAQQVEVL#GSAPGKDEADSKGASPWKSVRLAVQTTA 1206 Query 1204 TFN 1206 \|\| Sbjct 1207 NFN 1209

* References

[PubMed ID: 18073242] Creighton J, Zhu B, Alexeyev M, Stevens T, Spectrin-anchored phosphodiesterase 4D4 restricts cAMP from disrupting microtubules and inducing endothelial cell gap formation. J Cell Sci. 2008 Jan 1;121(Pt 1):110-9. Epub 2007 Dec 11.

» More (9) « Hide Below

[PubMed ID: 16882358] ... Warren MW, Zheng W, Kobeissy FH, Cheng Liu M, Hayes RL, Gold MS, Larner SF, Wang KK, Calpain- and caspase-mediated alphaII-spectrin and tau proteolysis in rat cerebrocortical neuronal cultures after ecstasy or methamphetamine exposure. Int J Neuropsychopharmacol. 2007 Aug;10(4):479-89. Epub 2006 Aug 2.

[PubMed ID: 17276456] ... Ursitti JA, Petrich BG, Lee PC, Resneck WG, Ye X, Yang J, Randall WR, Bloch RJ, Wang Y, Role of an alternatively spliced form of alphaII-spectrin in localization of connexin 43 in cardiomyocytes and regulation by stress-activated protein kinase. J Mol Cell Cardiol. 2007 Mar;42(3):572-81. Epub 2007 Feb 5.

[PubMed ID: 16870704] ... Liu L, Jedrychowski MP, Gygi SP, Pilch PF, Role of insulin-dependent cortical fodrin/spectrin remodeling in glucose transporter 4 translocation in rat adipocytes. Mol Biol Cell. 2006 Oct;17(10):4249-56. Epub 2006 Jul 26.

[PubMed ID: 16943668] ... Aikman J, O'Steen B, Silver X, Torres R, Boslaugh S, Blackband S, Padgett K, Wang KK, Hayes R, Pineda J, Alpha-II-spectrin after controlled cortical impact in the immature rat brain. Dev Neurosci. 2006;28(4-5):457-65.

[PubMed ID: 11509555] ... Bockers TM, Mameza MG, Kreutz MR, Bockmann J, Weise C, Buck F, Richter D, Gundelfinger ED, Kreienkamp HJ, Synaptic scaffolding proteins in rat brain. Ankyrin repeats of the multidomain Shank protein family interact with the cytoskeletal protein alpha-fodrin. J Biol Chem. 2001 Oct 26;276(43):40104-12. Epub 2001 Aug 16.

[PubMed ID: 11181835] ... Tamura Y, Ozkan ED, Bole DG, Ueda T, IPF, a vesicular uptake inhibitory protein factor, can reduce the Ca(2+)-dependent, evoked release of glutamate, GABA and serotonin. J Neurochem. 2001 Feb;76(4):1153-64.

[PubMed ID: 9108118] ... Ozkan ED, Lee FS, Ueda T, A protein factor that inhibits ATP-dependent glutamate and gamma-aminobutyric acid accumulation into synaptic vesicles: purification and initial characterization. Proc Natl Acad Sci U S A. 1997 Apr 15;94(8):4137-42.

[PubMed ID: 2753883] ... Hong WJ, Doyle D, Cloning and analysis of cDNA clones for rat kidney alpha-spectrin. J Biol Chem. 1989 Aug 5;264(22):12758-64.

[PubMed ID: 3336352] ... Leto TL, Fortugno-Erikson D, Barton D, Yang-Feng TL, Francke U, Harris AS, Morrow JS, Marchesi VT, Benz EJ Jr, Comparison of nonerythroid alpha-spectrin genes reveals strict homology among diverse species. Mol Cell Biol. 1988 Jan;8(1):1-9.