CaMPDB :: Substrate

XSB1872 : PREDICTED: similar to Beta crystallin A3 [Rattus norvegicus]

This entry is computationally expanded from SB0096

* Basic Information

Organism	Rattus norvegicus (Norway rat)
Protein Names	Beta-crystallin A3; Beta-crystallin A3, isoform A1, Delta4 form; Beta-crystallin A3, isoform A1, Delta7 form; Beta-crystallin A3, isoform A1, Delta8 form; similar to Beta crystallin A3
Gene Names	Cryba1; Derived by automated computational analysis using gene prediction method: GNOMON. Supporting evidence includes similarity to: 5 mRNAs, 79 ESTs, 17 Proteins
Gene Locus	Not available
GO Function	Not available

Entrez Protein	Entrez Nucleotide	Entrez Gene	UniProt	OMIM	HGNC	HPRD	KEGG
XP_340847	XM_340846	25583	P14881	N/A	N/A	N/A	rno:25583

* Information From OMIM

Not Available.

* Structure Information

1. Primary Information

Length: 215 aa

Average Mass: 25.270 kDa

Monoisotopic Mass: 25.254 kDa

2. Domain Information

Annotated Domains: interpro / pfam / smart / prosite

Computationally Assigned Domains (Pfam+HMMER):

domain name	begin	end	score	e-value
--- cleavage 11 ---
Crystall 1.	32	116	174.1	4.1e-49
Crystall 2.	125	213	185.0	2.2e-52

3. Sequence Information

Fasta Sequence: XSB1872.fasta

Amino Acid Sequence and Secondary Structures (PsiPred):

4. 3D Information

Not Available.

* Cleavage Information

1 [sites]

Cleavage sites (±10aa)

[Site 1] ETQTVQRELE¹¹-TLPTTKMAQT

Glu¹¹ Thr

P10	P9	P8	P7	P6	P5	P4	P3	P2	P1

Glu²	Thr³	Gln⁴	Thr⁵	Val⁶	Gln⁷	Arg⁸	Glu⁹	Leu¹⁰	Glu¹¹

P1'	P2'	P3'	P4'	P5'	P6'	P7'	P8'	P9'	P10'
Thr¹²	Leu¹³	Pro¹⁴	Thr¹⁵	Thr¹⁶	Lys¹⁷	Met¹⁸	Ala¹⁹	Gln²⁰	Thr²¹

Sequence conservation (by blast) Sequence conservation (by blast)

Reference peptide (cleaved bond±30 residues)
METQTVQRELETLPTTKMAQTNPMPGSMGPWKITIYDQENF

Summary

#	organism	max score	hits	top seq
1	Rattus norvegicus	89.40	2	PREDICTED: similar to Beta crystallin A3
2	Cavia porcellus	88.20	2	beta A3-crystallin
3	Mus musculus	88.20	2	crystallin, beta A1
4	Oryctolagus cuniculus	86.70	2	beta A3-crystallin
5	Canis lupus familiaris	85.50	1	crystallin, beta A1
6	N/A	84.70	5	-
7	Bos taurus	84.70	2	beta A3 crystallin
8	Contains: Beta crystallin A3, isoform A1, Delta4 form; Beta crystallin A3, isoform A1, Delta7 form; Beta crystallin A3, isoform A1, Delta8 form	84.70	1	CRBA1_BOVIN Beta crystallin A3
9	Macaca mulatta	81.30	1	PREDICTED: similar to crystallin, beta A3
10	Pan troglodytes	80.10	1	PREDICTED: similar to Beta crystallin A3
11	Homo sapiens	80.10	1	crystallin, beta A3
12	Monodelphis domestica	77.80	1	PREDICTED: similar to beta A3-crystallin
13	Rana catesbeiana	57.40	4	CRB32_RANCA Beta crystallin A3-2 emb
14	Xenopus laevis	50.80	2	crystallin, beta A1
15	Gallus gallus	50.10	1	crystallin, beta A1
16	Tetraodon nigroviridis	49.70	1	unnamed protein product
17	rats, Sprague-Dawley, lens, Peptide Partial, 20 aa	48.50	1	beta-crystallin isoform A3 {internal fragment}
18	Rana temporaria	46.60	2	unnamed protein product
19	Danio rerio	43.50	3	hypothetical protein LOC436859
20	Xenopus tropicalis	42.70	1	Unknown (protein for MGC:122148)

Top-ranked sequences

organism	matching
Rattus norvegicus	Query 1 METQTVQRELE#TLPTTKMAQTNPMPGSMGPWKITIYDQENF 41 \|\|\|\|\|\|\|\|\|\|\|#\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\| Query 1 METQTVQRELE#TLPTTKMAQTNPMPGSMGPWKITIYDQENF 41
Cavia porcellus	Query 1 METQTVQRELE#TLPTTKMAQTNPMPGSMGPWKITIYDQENF 41 \|\|\|\|\|\|\|\|\|\|\|#\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|+\|\|\|\|\|\|\|\|\|\|\|\|\| Sbjct 1 METQTVQRELE#TLPTTKMAQTNPMPGSLGPWKITIYDQENF 41
Mus musculus	Query 1 METQTVQRELE#TLPTTKMAQTNPMPGSMGPWKITIYDQENF 41 \|\|\|\|\|\|\|\|\|\|\|#\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|+\|\|\|\|\|\|\|\|\|\|\|\|\| Sbjct 1 METQTVQRELE#TLPTTKMAQTNPMPGSLGPWKITIYDQENF 41
Oryctolagus cuniculus	Query 1 METQTVQRELE#TLPTTKMAQTNPMPGSMGPWKITIYDQENF 41 \|\|\|\|\|\|\|+\|\|\|#\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|+\|\|\|\|\|\|\|\|\|\|\|\|\| Sbjct 1 METQTVQQELE#TLPTTKMAQTNPMPGSLGPWKITIYDQENF 41
Canis lupus familiaris	Query 1 METQTVQRELE#TLPTTKMAQTNPMPGSMGPWKITIYDQENF 41 \|\|\|\|\|\|\|+\|\|\|#\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\| \|\|\|\|\|\|\|\|\|\|\|\|\| Sbjct 1 METQTVQQELE#TLPTTKMAQTNPMPGSAGPWKITIYDQENF 41
N/A	Query 1 METQTVQRELE#TLPTTKMAQTNPMPGSMGPWKITIYDQENF 41 \|\|\|\|\|\|\|+\|\|\|#+\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|+\|\|\|\|\|\|\|\|\|\|\|\|\| Sbjct 1 METQTVQQELE#SLPTTKMAQTNPMPGSVGPWKITIYDQENF 41
Bos taurus	Query 1 METQTVQRELE#TLPTTKMAQTNPMPGSMGPWKITIYDQENF 41 \|\|\|\|\|\|\|+\|\|\|#+\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|+\|\|\|\|\|\|\|\|\|\|\|\|\| Sbjct 1 METQTVQQELE#SLPTTKMAQTNPMPGSVGPWKITIYDQENF 41
Contains: Beta crystallin A3, isoform A1, Delta4 form; Beta crystallin A3, isoform A1, Delta7 form; Beta crystallin A3, isoform A1, Delta8 form	Query 1 METQTVQRELE#TLPTTKMAQTNPMPGSMGPWKITIYDQENF 41 \|\|\|\|\|\|\|+\|\|\|#+\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|+\|\|\|\|\|\|\|\|\|\|\|\|\| Sbjct 1 METQTVQQELE#SLPTTKMAQTNPMPGSVGPWKITIYDQENF 41
Macaca mulatta	Query 1 METQTVQRELE#TLPTTKMAQTNPMPGSMGPWKITIYDQENF 41 \|\|\|\|\|\|\|+\|\|\|#\|\|\|\|\|\|\|\|\|\|\|\| \|\|+\|\|\|\|\|\|\|\|\|\|\|\|\| Sbjct 1 METQTVQQELE#TLPTTKMAQTNPTQGSLGPWKITIYDQENF 41
Pan troglodytes	Query 1 METQTVQRELE#TLPTTKMAQTNPMPGSMGPWKITIYDQENF 41 \|\|\|\| \|+\|\|\|#\|\|\|\|\|\|\|\|\|\|\|\| \|\|\|+\|\|\|\|\|\|\|\|\|\|\|\|\| Sbjct 1 METQAEQQELE#TLPTTKMAQTNPTPGSLGPWKITIYDQENF 41
Homo sapiens	Query 1 METQTVQRELE#TLPTTKMAQTNPMPGSMGPWKITIYDQENF 41 \|\|\|\| \|+\|\|\|#\|\|\|\|\|\|\|\|\|\|\|\| \|\|\|+\|\|\|\|\|\|\|\|\|\|\|\|\| Sbjct 1 METQAEQQELE#TLPTTKMAQTNPTPGSLGPWKITIYDQENF 41
Monodelphis domestica	Query 1 METQTVQRELE#TLPTTKMAQTNPMPGSMGPWKITIYDQENF 41 \|\|\|\| \|\|\|\|\|\|#\|+\| +\|\|\|\|\|\|\|\|\| +\|\|\|\|+\|\|\|\|\|\|\|\| Sbjct 1 METQAVQRELE#TVPAARMAQTNPMPGPLGPWKVTIYDQENF 41
Rana catesbeiana	Query 1 METQTVQRELE#TLPTTKMAQTNPMPGSMGPWKITIYDQENF 41 \|\| +\| \| \|# + + \|\|\|\| \|\|+\| +\|\|\|\|\|\|+\|\|\|\|\|\| Sbjct 1 MEIPAIQTERE#DITSEKMAQINPLPVPLGPWKITVYDQENF 41
Xenopus laevis	Query 1 METQTVQRELE#TLPTTKMAQTNPMPGSMGPWKITIYDQENF 41 \|\| \|\| \| \|# \| \|\|\|+\|\|\|+ \|\| \|\|\|\|+\|\|\|\|\|\| Sbjct 1 MEISPVQTERE#NF-TKKMAETNPLSMRMGSWKITVYDQENF 40
Gallus gallus	Query 18 MAQTNPMPGSMGPWKITIYDQENF 41 \|\|\|\|\|\|+\| \|\|\|\|\|\|\|+\|\|\|\|\|\| Sbjct 1 MAQTNPLPVPMGPWKITVYDQENF 24
Tetraodon nigroviridis	Query 16 TKMAQTNPMPGSMGPWKITIYDQENF 41 \|\|\|\|\|\|\|\|\|\| \|\|\|\|\|\|\|+\|\|\|\|+\| Sbjct 1 TKMAQTNPMP--MGPWKITVYDQEHF 24
rats, Sprague-Dawley, lens, Peptide Partial, 20 aa	Query 12 TLPTTKMAQTNPMPGSMGPW 31 \|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\| Query 12 TLPTTKMAQTNPMPGSMGPW 31
Rana temporaria	Query 18 MAQTNPMPGSMGPWKITIYDQENF 41 \|\|\| \|\|+\| +\|\|\|\|\|\|+\|\|\|\|\|\| Sbjct 1 MAQINPLPVPLGPWKITVYDQENF 24
Danio rerio	Query 18 MAQTNPMPGSMGPWKITIYDQENF 41 \|\| \|\|\|\| \|\|\|\|\|\|\|+\|\|\|\|+\| Sbjct 1 MALTNPMSMPMGPWKITVYDQEHF 24
Xenopus tropicalis	Query 18 MAQTNPMPGSMGPWKITIYDQENF 41 \|\|+\|\|\|+ \|\| \|\|\|\|+\|\|\|\|\|\| Sbjct 1 MAETNPLSMRMGSWKITVYDQENF 24

* References

None.