CaMPDB :: Substrate

XSB2121 : crystallin, beta B3 [Homo sapiens]

This entry is computationally expanded from SB0095

* Basic Information

Organism	Homo sapiens (human)
Protein Names	Beta-crystallin B3; Beta-B3 crystallin; crystallin; beta B3; eye lens structural protein
Gene Names	CRYBB3; CRYB3; crystallin, beta B3
Gene Locus	22q11.23; chromosome 22
GO Function	Not available

Entrez Protein	Entrez Nucleotide	Entrez Gene	UniProt	OMIM	HGNC	HPRD	KEGG
NP_004067	NM_004076	1417	P26998	123630	2400	N/A	hsa:1417

* Information From OMIM

Text: See OMIM:123610 for background on the crystallin gene family.

* Structure Information

1. Primary Information

Length: 211 aa

Average Mass: 24.252 kDa

Monoisotopic Mass: 24.237 kDa

2. Domain Information

Annotated Domains: interpro / pfam / smart / prosite

Computationally Assigned Domains (Pfam+HMMER):

domain name	begin	end	score	e-value
--- cleavage 15 ---
Crystall 1.	25	107	148.3	2.3e-41
Crystall 2.	115	197	159.0	1.4e-44

3. Sequence Information

Fasta Sequence: XSB2121.fasta

Amino Acid Sequence and Secondary Structures (PsiPred):

4. 3D Information

Not Available.

* Cleavage Information

1 [sites]

Cleavage sites (±10aa)

[Site 1] GAPEQAAAGK¹⁵-SHGDLGGSYK

Lys¹⁵ Ser

P10	P9	P8	P7	P6	P5	P4	P3	P2	P1

Gly⁶	Ala⁷	Pro⁸	Glu⁹	Gln¹⁰	Ala¹¹	Ala¹²	Ala¹³	Gly¹⁴	Lys¹⁵

P1'	P2'	P3'	P4'	P5'	P6'	P7'	P8'	P9'	P10'
Ser¹⁶	His¹⁷	Gly¹⁸	Asp¹⁹	Leu²⁰	Gly²¹	Gly²²	Ser²³	Tyr²⁴	Lys²⁵

Sequence conservation (by blast) Sequence conservation (by blast)

Reference peptide (cleaved bond±30 residues)
MAEQHGAPEQAAAGKSHGDLGGSYKVILYELENFQGKRCELSAEC

Summary

#	organism	max score	hits	top seq
1	Homo sapiens	96.70	6	Crystallin, beta B3
2	Pan troglodytes	91.30	5	PREDICTED: crystallin, beta B3 isoform 1
3	Mus musculus	90.90	5	crystallin, beta B3
4	Macaca mulatta	90.90	3	PREDICTED: crystallin, beta B2 isoform 1
5	Cavia porcellus	89.40	3	betaB3-crystallin
6	N/A	88.60	8	C
7	Rattus norvegicus	88.60	7	crystallin, beta B3
8	Ovis aries	88.60	1	crystallin, beta B3
9	Bos taurus	87.00	4	crystallin, beta B3
10	Xenopus laevis	74.70	8	MGC84109 protein
11	Danio rerio	62.40	13	beta B3-crystallin
12	Gallus gallus	61.20	3	crystallin, beta B3
13	Tetraodon nigroviridis	60.10	5	unnamed protein product
14	Sus scrofa	40.40	1	beta crystallin subunit beta B1
15	Canis familiaris	40.00	1	PREDICTED: similar to crystallin, beta B1
16	Dicentrarchus labrax	40.00	1	crystallin beta B1
17	synthetic construct	39.70	1	crystallin beta B1
18	Monodelphis domestica	38.50	3	PREDICTED: similar to betaB2-crystallin
19	Xenopus tropicalis	38.10	2	crystallin, beta B1
20	Contains: Beta crystallin B1B	38.10	1	CRBB1_RAT Beta crystallin B1
21	Cynops pyrrhogaster	37.40	1	newt beta B1-crystallin
22	Iguana iguana	35.40	1	betaA2-crystallin
23	Oryctolagus cuniculus	33.90	2	beta A3-crystallin
24	Contains: Beta crystallin A3, isoform A1, Delta4 form; Beta crystallin A3, isoform A1, Delta7 form; Beta crystallin A3, isoform A1, Delta8 form	33.90	1	CRBA1_BOVIN Beta crystallin A3
25	Canis lupus familiaris	33.90	1	crystallin, beta A1
26	Rana catesbeiana	33.50	4	CRB31_RANCA Beta crystallin A3-1 emb
27	Rana temporaria	33.50	2	unnamed protein product
28	Macropus fuliginosus	33.10	1	betaA2-crystallin

Top-ranked sequences

organism	matching
Homo sapiens	Query 1 MAEQHGAPEQAAAGK#SHGDLGGSYKVILYELENFQGKRCELSAEC 45 \|\|\|\|\|\|\|\|\|\|\|\|\|\|\|#\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\| Query 1 MAEQHGAPEQAAAGK#SHGDLGGSYKVILYELENFQGKRCELSAEC 45
Pan troglodytes	Query 1 MAEQHGAPEQAAAGK#SHGDLGGSYKVILYELENFQGKRCELSAEC 45 \|\|\|\|\|\| \|\|\|\|\|\|\|\|#\|\|\| \|\|\|\|\|\|\|\|+\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\| Sbjct 1 MAEQHGTPEQAAAGK#SHGGLGGSYKVIVYELENFQGKRCELSAEC 45
Mus musculus	Query 1 MAEQHGAPEQAAAGK#SHGDLGGSYKVILYELENFQGKRCELSAEC 45 \|\|\|\|\|\|\|\|\|\|\|\|\|\|\|#\|\|\| \|\|\|\|\|\|\| +\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\| Sbjct 1 MAEQHGAPEQAAAGK#SHGGLGGSYKVTVYELENFQGKRCELSAEC 45
Macaca mulatta	Query 1 MAEQHGAPEQAAAGK#SHGDLGGSYKVILYELENFQGKRCELSAEC 45 \|\|\|\|\|\|\|\|\|\|\|\|\|\|\|#\|\|\| \|\|\|\|\|\|\|\|+\|\|\|\|\|\|\|\|\| \|\|\|\|\|\|\| Sbjct 1 MAEQHGAPEQAAAGK#SHGGLGGSYKVIVYELENFQGKHCELSAEC 45
Cavia porcellus	Query 1 MAEQHGAPEQAAAGK#SHGDLGGSYKVILYELENFQGKRCELSAEC 45 \|\|\|\|\|\|\|\|\|\|\|\|\|\|\|#\|\|\| \|\|\| \|\|\| +\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\| Sbjct 1 MAEQHGAPEQAAAGK#SHGGLGGGYKVTVYELENFQGKRCELSAEC 45
N/A	Query 1 MAEQHGAPEQAAAGK#SHGDLGGSYKVILYELENFQGKRCELSAEC 45 \|\|\|\|\|\|\|\|\|\|\|\|\| \|#\|\|\| \|\|\|\|\|\|\| +\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\| Sbjct 1 MAEQHGAPEQAAASK#SHGGLGGSYKVTVYELENFQGKRCELSAEC 45
Rattus norvegicus	Query 1 MAEQHGAPEQAAAGK#SHGDLGGSYKVILYELENFQGKRCELSAEC 45 \|\|\|\|\|\|\|\|\|\|\|\|\| \|#\|\|\| \|\|\|\|\|\|\| +\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\| Sbjct 1 MAEQHGAPEQAAANK#SHGGLGGSYKVTVYELENFQGKRCELSAEC 45
Ovis aries	Query 1 MAEQHGAPEQAAAGK#SHGDLGGSYKVILYELENFQGKRCELSAEC 45 \|\|\|\|\| \|\|\|\|\|\|\|\|\|#\|\|\| \|\|\|\|\|\|\|\|+\|\|+\|\|\|\|\|\|\|\|\|\|+\|\|\| Sbjct 1 MAEQHSAPEQAAAGK#SHGGLGGSYKVIVYEMENFQGKRCELTAEC 45
Bos taurus	Query 1 MAEQHGAPEQAAAGK#SHGDLGGSYKVILYELENFQGKRCELSAEC 45 \|\|\|\|\| \|\|\|\|\|\|\|\|#\|\|\| \|\|\|\|\|\|\|\|+\|\|+\|\|\|\|\|\|\|\|\|\|+\|\|\| Sbjct 1 MAEQHSTPEQAAAGK#SHGGLGGSYKVIVYEMENFQGKRCELTAEC 45
Xenopus laevis	Query 1 MAEQHGAPEQAAAGK#SHGDLGGSYKVILYELENFQGKRCELSAEC 45 \|+\| \|\|\|\| \|\|\|\|#\|\|\| +\|\|+\|\|+ \|\|\|\|\|\|\|\|\|\|+\|\|\|+ \|\| Sbjct 1 MSELQSAPEQMAAGK#SHGGIGGNYKITLYELENFQGKKCELTGEC 45
Danio rerio	Query 1 MAEQHGAPEQAAAGK#SHGDLGGSYKVILYELENFQGKRCELSAEC 45 \|++\| \| \|+\| \|\|\|#\| \| \| \|\|\| \|\|\| \|\|\|+\|\|+ \|\|\|\|\|\| Sbjct 1 MSDQQGVPDQQVAGK#SQGGAGAIYKVSLYEFENFRGKKLELSAEC 45
Gallus gallus	Query 1 MAEQHGAPEQAAAGK#SHGDLGGSYKVILYELENFQGKRCELSAE 44 \| \|\| \|\|\| \|+# \|+ \|\|+\|\|+ +\|\|\|\|\|\|\|\|+\|\|\|\|\| \| Sbjct 1 MTEQQSPPEQMVTGE#GAGERGGNYKITIYELENFQGRRCELSEE 44
Tetraodon nigroviridis	Query 1 MAEQHGAPEQAAAGK#SHGDLGGSYKVILYELENFQGKRCELSAEC 45 \|+\|+ \|\|\|\| \|\|\|\|#\| \| \| +\|\|\|+\|+\| \|\|\|\|\| + \| \|++\| Sbjct 33 MSERQSAPEQLAAGK#SQGGAGATYKVLLFEFENFQGCKAEFSSDC 77
Sus scrofa	Query 8 PEQAAAGK---#SHGDLG-GSYKVILYELENFQGKRCELSAEC 45 \| \|\| \| #+ \|\|\| \|\|\|\|++++\| \|\|\|\|\|+\| \| \| \|\| Sbjct 36 PAQAPAQPMPA#AKGDLPPGSYKLVVFEQENFQGRRVEFSGEC 77
Canis familiaris	Query 18 GDLG-GSYKVILYELENFQGKRCELSAEC 45 \|\|\| \|\|\|\|++++\| \|\|\|\|\|+\| \| \| \|\| Sbjct 48 GDLPPGSYKLVVFEQENFQGRRVEFSGEC 76
Dicentrarchus labrax	Query 2 AEQHGAPEQAAAGK#SH--GDLG-GSYKVILYELENFQGKRCELSAEC 45 \|+ \|\|\| \|\|+ \|#+ \|+ \| \|\|\|++++++ \|\|\|\|\|+ \|+ \|\| Sbjct 15 AKDKGAPAPAASSK#ATKTGEPGMGSYRIMMFDQENFQGRMIEVQNEC 61
synthetic construct	Query 22 GSYKVILYELENFQGKRCELSAEC 45 \|+\|+++++\|\|\|\|\|\|\|+\| \| \| \|\| Sbjct 57 GNYRLVVFELENFQGRRAEFSGEC 80
Monodelphis domestica	Query 1 MAEQHGAPEQAAAGK#SHGDLGGSYK 25 \| \|\| \|\|\|\|\|\|\|\|#\|\|\| \|\|\|\|+\| Sbjct 125 MMEQQSVPEQAAAGK#SHGGLGGSFK 149 Query 23 SYKVILYELENFQGKRCELSAEC 45 \| +\| ++\|\|\|\|\|\|\|\|+\|+\|\| \|\| Sbjct 215 SLQVSIFELENFQGKKCDLSTEC 237
Xenopus tropicalis	Query 7 APEQAAAGK#SHGD-LGGSYKVILYELENFQGKRCELSAEC 45 \|\| +\| # \|\| + \|\|+\|++\|+\| \|\|\|\|\|+ \|\| \|\| Sbjct 19 APVPSAKPT#RTGDPMMGSFKIVLFEQENFQGRHVELLNEC 58
Contains: Beta crystallin B1B	Query 22 GSYKVILYELENFQGKRCELSAEC 45 \|\|\|+++++\| \|\|\|\|\|+\| \| \| \|\| Sbjct 55 GSYRLVVFEQENFQGRRVEFSGEC 78
Cynops pyrrhogaster	Query 2 AEQHGAPEQAAAGK#SH--GDLG-GSYKVILYELENFQGKRCELSAEC 45 +++ \| \| \|# + \|\| \|+\|\|+\|++\| \|\|\|\|\|+ \|\| \|\| Sbjct 23 SKEKGVPPSVPISK#PNKAGDSSVGTYKIIIFEQENFQGRHLELVNEC 69
Iguana iguana	Query 22 GSYKVILYELENFQGKRCELSAEC 45 \| +\|+ ++\| \|\|\|\|\|+\|\|\| \|\| Sbjct 3 GQFKITVWEEENFQGERCEFLMEC 26
Oryctolagus cuniculus	Query 22 GSYKVILYELENFQGKRCELSAEC 45 \| +\|+ +\|+ \|\|\|\|\|\|\| \| ++ \| Sbjct 29 GPWKITIYDQENFQGKRMEFTSSC 52
Contains: Beta crystallin A3, isoform A1, Delta4 form; Beta crystallin A3, isoform A1, Delta7 form; Beta crystallin A3, isoform A1, Delta8 form	Query 22 GSYKVILYELENFQGKRCELSAEC 45 \| +\|+ +\|+ \|\|\|\|\|\|\| \| ++ \| Sbjct 29 GPWKITIYDQENFQGKRMEFTSSC 52
Canis lupus familiaris	Query 22 GSYKVILYELENFQGKRCELSAEC 45 \| +\|+ +\|+ \|\|\|\|\|\|\| \| ++ \| Sbjct 29 GPWKITIYDQENFQGKRMEFTSSC 52
Rana catesbeiana	Query 22 GSYKVILYELENFQGKRCELSAEC 45 \| +\|+ +\|+ \|\|\|\|\|\|\| \| ++ \| Sbjct 29 GPWKITVYDQENFQGKRMEFTSSC 52
Rana temporaria	Query 22 GSYKVILYELENFQGKRCELSAEC 45 \| +\|+ +\|+ \|\|\|\|\|\|\| \| ++ \| Sbjct 12 GPWKITVYDQENFQGKRMEFTSSC 35
Macropus fuliginosus	Query 25 KVILYELENFQGKRCELSAEC 45 ++ \|+\| \|\|\|\|\|+\|\|\|\| ++\| Sbjct 13 RLTLWEEENFQGRRCELMSDC 33

* References

[PubMed ID: 18162101] Muller C, Distl O, Linkage and association analyses of intragenic SNPs in the canine beta-crystallin genes CRYBB1, CRYBB2, CRYBB3, CRYBA1 and CRYBA4 with primary cataracts in wire-haired Dachshunds. Anim Genet. 2008 Feb;39(1):87-8. Epub 2007 Dec 19.

» More (10) « Hide Below

[PubMed ID: 17474147] ... Wu C, Ma MH, Brown KR, Geisler M, Li L, Tzeng E, Jia CY, Jurisica I, Li SS, Systematic identification of SH3 domain-mediated human protein-protein interactions by peptide array target screening. Proteomics. 2007 Jun;7(11):1775-85.

[PubMed ID: 15914629] ... Riazuddin SA, Yasmeen A, Yao W, Sergeev YV, Zhang Q, Zulfiqar F, Riaz A, Riazuddin S, Hejtmancik JF, Mutations in betaB3-crystallin associated with autosomal recessive cataract in two Pakistani families. Invest Ophthalmol Vis Sci. 2005 Jun;46(6):2100-6.

[PubMed ID: 15461802] ... Collins JE, Wright CL, Edwards CA, Davis MP, Grinham JA, Cole CG, Goward ME, Aguado B, Mallya M, Mokrab Y, Huckle EJ, Beare DM, Dunham I, A genome annotation-driven approach to cloning the human ORFeome. Genome Biol. 2004;5(10):R84. Epub 2004 Sep 30.

[PubMed ID: 12060738] ... MacCoss MJ, McDonald WH, Saraf A, Sadygov R, Clark JM, Tasto JJ, Gould KL, Wolters D, Washburn M, Weiss A, Clark JI, Yates JR 3rd, Shotgun identification of protein modifications from protein complexes and lens tissue. Proc Natl Acad Sci U S A. 2002 Jun 11;99(12):7900-5.

[PubMed ID: 10591208] ... Dunham I, Shimizu N, Roe BA, Chissoe S, Hunt AR, Collins JE, Bruskiewich R, Beare DM, Clamp M, Smink LJ, Ainscough R, Almeida JP, Babbage A, Bagguley C, Bailey J, Barlow K, Bates KN, Beasley O, Bird CP, Blakey S, Bridgeman AM, Buck D, Burgess J, Burrill WD, O'Brien KP, et al., The DNA sequence of human chromosome 22. Nature. 1999 Dec 2;402(6761):489-95.

[PubMed ID: 8999933] ... Lampi KJ, Ma Z, Shih M, Shearer TR, Smith JB, Smith DL, David LL, Sequence analysis of betaA3, betaB3, and betaA4 crystallins completes the identification of the major proteins in young human lens. J Biol Chem. 1997 Jan 24;272(4):2268-75.

[PubMed ID: 9183670] ... Kimoto Y, A possibility of all mRNA expression in a human single lymphocyte. Hum Cell. 1996 Dec;9(4):367-70.

[PubMed ID: 8812489] ... Kramer P, Yount J, Mitchell T, LaMorticella D, Carrero-Valenzuela R, Lovrien E, Maumenee I, Litt M, A second gene for cerulean cataracts maps to the beta crystallin region on chromosome 22. Genomics. 1996 Aug 1;35(3):539-42.

[PubMed ID: 2499686] ... Aarts HJ, Jacobs EH, van Willigen G, Lubsen NH, Schoenmakers JG, Different evolution rates within the lens-specific beta-crystallin gene family. J Mol Evol. 1989 Apr;28(4):313-21.