XSB2147 : unnamed protein product [Mus musculus]
[ CaMP Format ]
This entry is computationally expanded from SB0097
* Basic Information
| Organism | Mus musculus (house mouse) |
| Protein Names | Putative uncharacterized protein |
| Gene Names | Igfbp2 |
| Gene Locus | Not available |
| GO Function | Not available |
| Entrez Protein | Entrez Nucleotide | Entrez Gene | UniProt | OMIM | HGNC | HPRD | KEGG |
|---|---|---|---|---|---|---|---|
| BAB27842 | N/A | N/A | Q9D057_MOUSE | N/A | N/A | N/A | mmu: |
* Information From OMIM
Not Available.
* Structure Information
1. Primary Information
Length: 304 aa
Average Mass: 33.106 kDa
Monoisotopic Mass: 33.085 kDa
2. Domain Information
Annotated Domains: interpro / pfam / smart / prosite
Computationally Assigned Domains (Pfam+HMMER):
| domain name | begin | end | score | e-value |
|---|---|---|---|---|
| IGFBP 1. | 40 | 99 | 32.6 | 1.6e-06 |
| --- cleavage 179 --- | ||||
| Thyroglobulin_1 1. | 206 | 285 | 147.9 | 3.1e-41 |
3. Sequence Information
Fasta Sequence: XSB2147.fasta
Amino Acid Sequence and Secondary Structures (PsiPred):
4. 3D Information
Not Available.
* Cleavage Information
1 [sites]
Cleavage sites (±10aa)
[Site 1] VFREKVNEQH179-RQMGKGAKHL
His179 
Arg
 |
|||||||||
| P10 | P9 | P8 | P7 | P6 | P5 | P4 | P3 | P2 | P1 |
|---|---|---|---|---|---|---|---|---|---|
| Val170 | Phe171 | Arg172 | Glu173 | Lys174 | Val175 | Asn176 | Glu177 | Gln178 | His179 |
 |
|||||||||
| P1' | P2' | P3' | P4' | P5' | P6' | P7' | P8' | P9' | P10' |
| Arg180 | Gln181 | Met182 | Gly183 | Lys184 | Gly185 | Ala186 | Lys187 | His188 | Leu189 |
Sequence conservation (by blast)
Sequence conservation (by blast)
| Reference peptide (cleaved bond±30 residues) |
|---|
| LGGGSSAGRKPLKSGMKELAVFREKVNEQHRQMGKGAKHLSLEEPKKLRPPPARTPCQQE |
Summary
| # | organism | max score | hits | top seq |
|---|---|---|---|---|
| 1 | Mus musculus | 125.00 | 3 | unnamed protein product |
| 2 | N/A | 125.00 | 2 | - |
| 3 | Rattus norvegicus | 119.00 | 3 | insulin-like growth factor binding protein 2 |
| 4 | Homo sapiens | 114.00 | 5 | unnamed protein product |
| 5 | Pan troglodytes | 114.00 | 1 | PREDICTED: insulin-like growth factor binding prot |
| 6 | synthetic construct | 114.00 | 1 | insulin-like growth factor binding protein 2, 36kD |
| 7 | Macaca mulatta | 113.00 | 1 | PREDICTED: insulin-like growth factor binding prot |
| 8 | Bubalus bubalis | 112.00 | 1 | insulin-like growth factor binding protein-2 |
| 9 | Bos taurus | 112.00 | 1 | insulin-like growth factor binding protein 2, 36kD |
| 10 | Canis familiaris | 111.00 | 1 | PREDICTED: similar to Insulin-like growth factor b |
| 11 | Sus scrofa | 109.00 | 1 | insulin-like growth factor binding protein 2 |
| 12 | Ovis aries | 106.00 | 1 | insulin-like growth factor-binding protein-2 |
| 13 | Equus caballus | 92.80 | 1 | insulin-like growth factor binding protein-2 |
| 14 | Monodelphis domestica | 76.60 | 1 | PREDICTED: similar to Insulin-like growth factor-b |
| 15 | Gallus gallus | 75.10 | 3 | insulin-like growth factor binding protein 2 |
| 16 | Coturnix coturnix | 60.50 | 1 | AF260701_1 IGF binding protein 2 |
| 17 | Xenopus tropicalis | 40.40 | 1 | Unknown (protein for MGC:121849) |
Top-ranked sequences
| organism | matching |
|---|---|
| Mus musculus | Query 150 LGGGSSAGRKPLKSGMKELAVFREKVNEQH#RQMGKGAKHLSLEEPKKLRPPPARTPCQQE 209 ||||||||||||||||||||||||||||||#|||||||||||||||||||||||||||||| Query 150 LGGGSSAGRKPLKSGMKELAVFREKVNEQH#RQMGKGAKHLSLEEPKKLRPPPARTPCQQE 209 |
| N/A | Query 150 LGGGSSAGRKPLKSGMKELAVFREKVNEQH#RQMGKGAKHLSLEEPKKLRPPPARTPCQQE 209 ||||||||||||||||||||||||||||||#|||||||||||||||||||||||||||||| Query 150 LGGGSSAGRKPLKSGMKELAVFREKVNEQH#RQMGKGAKHLSLEEPKKLRPPPARTPCQQE 209 |
| Rattus norvegicus | Query 152 GGSSAGRKPLKSGMKELAVFREKVNEQH#RQMGKGAKHLSLEEPKKLRPPPARTPCQQE 209 ||||||||| ||||||||||||||||||#|||||||||||||||||||||||||||||| Sbjct 152 GGSSAGRKPPKSGMKELAVFREKVNEQH#RQMGKGAKHLSLEEPKKLRPPPARTPCQQE 209 |
| Homo sapiens | Query 150 LGGGSSAGRKPLKSGMKELAVFREKVNEQH#RQMGKGAK-HLSLEEPKKLRPPPARTPCQQ 208 |||| ||||||||||||||||||||| |||#|||||| | || |||||||||||||||||| Sbjct 173 LGGGGSAGRKPLKSGMKELAVFREKVTEQH#RQMGKGGKHHLGLEEPKKLRPPPARTPCQQ 232 Query 209 E 209 | Query 209 E 209 |
| Pan troglodytes | Query 150 LGGGSSAGRKPLKSGMKELAVFREKVNEQH#RQMGKGAK-HLSLEEPKKLRPPPARTPCQQ 208 |||| ||||||||||||||||||||| |||#|||||| | || |||||||||||||||||| Sbjct 291 LGGGGSAGRKPLKSGMKELAVFREKVTEQH#RQMGKGGKHHLGLEEPKKLRPPPARTPCQQ 350 Query 209 E 209 | Query 209 E 209 |
| synthetic construct | Query 150 LGGGSSAGRKPLKSGMKELAVFREKVNEQH#RQMGKGAK-HLSLEEPKKLRPPPARTPCQQ 208 |||| ||||||||||||||||||||| |||#|||||| | || |||||||||||||||||| Sbjct 173 LGGGGSAGRKPLKSGMKELAVFREKVTEQH#RQMGKGGKHHLGLEEPKKLRPPPARTPCQQ 232 Query 209 E 209 | Query 209 E 209 |
| Macaca mulatta | Query 150 LGGGSSAGRKPLKSGMKELAVFREKVNEQH#RQMGKGAK-HLSLEEPKKLRPPPARTPCQQ 208 |||| ||||||||||||||||||||| |||#|||||| | || |||||||||||||||||| Sbjct 171 LGGGGSAGRKPLKSGMKELAVFREKVAEQH#RQMGKGGKHHLGLEEPKKLRPPPARTPCQQ 230 Query 209 E 209 | Query 209 E 209 |
| Bubalus bubalis | Query 150 LGGGSSAGRKPLKSGMKELAVFREKVNEQH#RQMGKGAK-HLSLEEPKKLRPPPARTPCQQ 208 +||| |||||||||||||||||||| |||#|||||| | || |||||||||||||||||| Sbjct 36 MGGGGGAGRKPLKSGMKELAVFREKVTEQH#RQMGKGGKHHLGLEEPKKLRPPPARTPCQQ 95 Query 209 E 209 | Query 209 E 209 |
| Bos taurus | Query 150 LGGGSSAGRKPLKSGMKELAVFREKVNEQH#RQMGKGAK-HLSLEEPKKLRPPPARTPCQQ 208 +||| |||||||||||||||||||| |||#|||||| | || |||||||||||||||||| Sbjct 162 MGGGGGAGRKPLKSGMKELAVFREKVTEQH#RQMGKGGKHHLGLEEPKKLRPPPARTPCQQ 221 Query 209 E 209 | Query 209 E 209 |
| Canis familiaris | Query 150 LGGGSSAGRKPLKSGMKELAVFREKVNEQH#RQMGKGAK-HLSLEEPKKLRPPPARTPCQQ 208 |||| |||||||||||||||||||| |||#|||||| | || |+|||||||||||||||| Sbjct 116 LGGGGGAGRKPLKSGMKELAVFREKVTEQH#RQMGKGGKHHLGLDEPKKLRPPPARTPCQQ 175 Query 209 E 209 | Query 209 E 209 |
| Sus scrofa | Query 150 LGGGSSAGRKPLKSGMKELAVFREKVNEQH#RQMGKGAK-HLSLEEPKKLRPPPARTPCQQ 208 ||| |||||||||||||||||||| |||#|||||| | || |||||||||||||||||| Sbjct 161 LGGTGGAGRKPLKSGMKELAVFREKVTEQH#RQMGKGGKHHLGLEEPKKLRPPPARTPCQQ 220 Query 209 E 209 | Query 209 E 209 |
| Ovis aries | Query 150 LGGGSSAGRKPLKSGMKELAVFREKVNEQH#RQMGKGAK-HLSLEEPKKLRPPPARTPCQQ 208 +||| ||||||| ||||||||||| |||#|||||| | || |||||||||||||||||| Sbjct 162 MGGGGGAGRKPLKFRMKELAVFREKVTEQH#RQMGKGGKHHLGLEEPKKLRPPPARTPCQQ 221 Query 209 E 209 | Query 209 E 209 |
| Equus caballus | Query 157 GRKPLKSGMKELAVFREKVNEQH#RQMGKGAK--HLSLEEPKKLRPPPARTPCQQE 209 ||||||||||||||+||||+ ||#||||+| | |+ |||||||||| |||||||| Sbjct 1 GRKPLKSGMKELAVYREKVSGQH#RQMGRGGKHHHVVLEEPKKLRPPSARTPCQQE 55 |
| Monodelphis domestica | Query 150 LGGGSSAGRKPLKSGMKELAVFREKVNEQH#RQMGKGAKHLSL-EEPKKLRPPPARTPCQQ 208 |||| ||| ||||||||| |||| ||#||+|| | + |+ ||||||| |||||| Sbjct 167 LGGGV---RKPHKSGMKELAVIREKVIGQH#RQLGKVNMHHHIHEDTKKLRPPPTRTPCQQ 223 Query 209 E 209 | Query 209 E 209 |
| Gallus gallus | Query 150 LGGGSSAGRKPLKSGMKELAVFREKVNEQH#RQMGK-GAKHLSLEEPKKLRPPPARTPCQQ 208 | | || |||||+||||+|| ||||||| #||||| | | + |+ || | | |||||| Sbjct 55 LSGASS--RKPLKTGMKEMAVMREKVNEQQ#RQMGKVGKAHHNHEDSKKSRMPTGRTPCQQ 112 Query 209 E 209 | Query 209 E 209 |
| Coturnix coturnix | Query 165 MKELAVFREKVNEQH#RQMGK-GAKHLSLEEPKKLRPPPARTPCQQE 209 |||+|| ||||||| #||||| | | + |+ || | | ||||||| Sbjct 1 MKEMAVMREKVNEQQ#RQMGKVGKAHHNHEDSKKSRMPTGRTPCQQE 46 |
| Xenopus tropicalis | Query 153 GSSAGRKPLKSGMKELAVFREKVNEQH#RQMGKGAKHLSLEEPKKLRPPPARTPCQ 207 | +| ||| | |||+|| ||+ ||| #| +| |+ |+ |||+ || Sbjct 143 GEAAPRKPSKKEMKEIAVTRERANEQQ#R-----SKSNKSEDKKR----PARSLCQ 188 |
* References
[PubMed ID: 10349636] Carninci P, Hayashizaki Y, High-efficiency full-length cDNA cloning. Methods Enzymol. 1999;303:19-44.
[PubMed ID: 11042159] ... Carninci P, Shibata Y, Hayatsu N, Sugahara Y, Shibata K, Itoh M, Konno H, Okazaki Y, Muramatsu M, Hayashizaki Y, Normalization and subtraction of cap-trapper-selected cDNAs to prepare full-length cDNA libraries for rapid discovery of new genes. Genome Res. 2000 Oct;10(10):1617-30.
[PubMed ID: 11076861] ... Shibata K, Itoh M, Aizawa K, Nagaoka S, Sasaki N, Carninci P, Konno H, Akiyama J, Nishi K, Kitsunai T, Tashiro H, Itoh M, Sumi N, Ishii Y, Nakamura S, Hazama M, Nishine T, Harada A, Yamamoto R, Matsumoto H, Sakaguchi S, Ikegami T, Kashiwagi K, Fujiwake S, Inoue K, Togawa Y, RIKEN integrated sequence analysis (RISA) system--384-format sequencing pipeline with 384 multicapillary sequencer. Genome Res. 2000 Nov;10(11):1757-71.
[PubMed ID: 11217851] ... Kawai J, Shinagawa A, Shibata K, Yoshino M, Itoh M, Ishii Y, Arakawa T, Hara A, Fukunishi Y, Konno H, Adachi J, Fukuda S, Aizawa K, Izawa M, Nishi K, Kiyosawa H, Kondo S, Yamanaka I, Saito T, Okazaki Y, Gojobori T, Bono H, Kasukawa T, Saito R, Kadota K, Matsuda H, Ashburner M, Batalov S, Casavant T, Fleischmann W, Gaasterland T, Gissi C, King B, Kochiwa H, Kuehl P, Lewis S, Matsuo Y, Nikaido I, Pesole G, Quackenbush J, Schriml LM, Staubli F, Suzuki R, Tomita M, Wagner L, Washio T, Sakai K, Okido T, Furuno M, Aono H, Baldarelli R, Barsh G, Blake J, Boffelli D, Bojunga N, Carninci P, de Bonaldo MF, Brownstein MJ, Bult C, Fletcher C, Fujita M, Gariboldi M, Gustincich S, Hill D, Hofmann M, Hume DA, Kamiya M, Lee NH, Lyons P, Marchionni L, Mashima J, Mazzarelli J, Mombaerts P, Nordone P, Ring B, Ringwald M, Rodriguez I, Sakamoto N, Sasaki H, Sato K, Schonbach C, Seya T, Shibata Y, Storch KF, Suzuki H, Toyo-oka K, Wang KH, Weitz C, Whittaker C, Wilming L, Wynshaw-Boris A, Yoshida K, Hasegawa Y, Kawaji H, Kohtsuki S, Hayashizaki Y, Functional annotation of a full-length mouse cDNA collection. Nature. 2001 Feb 8;409(6821):685-90.
[PubMed ID: 12466851] ... Okazaki Y, Furuno M, Kasukawa T, Adachi J, Bono H, Kondo S, Nikaido I, Osato N, Saito R, Suzuki H, Yamanaka I, Kiyosawa H, Yagi K, Tomaru Y, Hasegawa Y, Nogami A, Schonbach C, Gojobori T, Baldarelli R, Hill DP, Bult C, Hume DA, Quackenbush J, Schriml LM, Kanapin A, Matsuda H, Batalov S, Beisel KW, Blake JA, Bradt D, Brusic V, Chothia C, Corbani LE, Cousins S, Dalla E, Dragani TA, Fletcher CF, Forrest A, Frazer KS, Gaasterland T, Gariboldi M, Gissi C, Godzik A, Gough J, Grimmond S, Gustincich S, Hirokawa N, Jackson IJ, Jarvis ED, Kanai A, Kawaji H, Kawasawa Y, Kedzierski RM, King BL, Konagaya A, Kurochkin IV, Lee Y, Lenhard B, Lyons PA, Maglott DR, Maltais L, Marchionni L, McKenzie L, Miki H, Nagashima T, Numata K, Okido T, Pavan WJ, Pertea G, Pesole G, Petrovsky N, Pillai R, Pontius JU, Qi D, Ramachandran S, Ravasi T, Reed JC, Reed DJ, Reid J, Ring BZ, Ringwald M, Sandelin A, Schneider C, Semple CA, Setou M, Shimada K, Sultana R, Takenaka Y, Taylor MS, Teasdale RD, Tomita M, Verardo R, Wagner L, Wahlestedt C, Wang Y, Watanabe Y, Wells C, Wilming LG, Wynshaw-Boris A, Yanagisawa M, Yang I, Yang L, Yuan Z, Zavolan M, Zhu Y, Zimmer A, Carninci P, Hayatsu N, Hirozane-Kishikawa T, Konno H, Nakamura M, Sakazume N, Sato K, Shiraki T, Waki K, Kawai J, Aizawa K, Arakawa T, Fukuda S, Hara A, Hashizume W, Imotani K, Ishii Y, Itoh M, Kagawa I, Miyazaki A, Sakai K, Sasaki D, Shibata K, Shinagawa A, Yasunishi A, Yoshino M, Waterston R, Lander ES, Rogers J, Birney E, Hayashizaki Y, Analysis of the mouse transcriptome based on functional annotation of 60,770 full-length cDNAs. Nature. 2002 Dec 5;420(6915):563-73.
[PubMed ID: 16141072] ... Carninci P, Kasukawa T, Katayama S, Gough J, Frith MC, Maeda N, Oyama R, Ravasi T, Lenhard B, Wells C, Kodzius R, Shimokawa K, Bajic VB, Brenner SE, Batalov S, Forrest AR, Zavolan M, Davis MJ, Wilming LG, Aidinis V, Allen JE, Ambesi-Impiombato A, Apweiler R, Aturaliya RN, Bailey TL, Bansal M, Baxter L, Beisel KW, Bersano T, Bono H, Chalk AM, Chiu KP, Choudhary V, Christoffels A, Clutterbuck DR, Crowe ML, Dalla E, Dalrymple BP, de Bono B, Della Gatta G, di Bernardo D, Down T, Engstrom P, Fagiolini M, Faulkner G, Fletcher CF, Fukushima T, Furuno M, Futaki S, Gariboldi M, Georgii-Hemming P, Gingeras TR, Gojobori T, Green RE, Gustincich S, Harbers M, Hayashi Y, Hensch TK, Hirokawa N, Hill D, Huminiecki L, Iacono M, Ikeo K, Iwama A, Ishikawa T, Jakt M, Kanapin A, Katoh M, Kawasawa Y, Kelso J, Kitamura H, Kitano H, Kollias G, Krishnan SP, Kruger A, Kummerfeld SK, Kurochkin IV, Lareau LF, Lazarevic D, Lipovich L, Liu J, Liuni S, McWilliam S, Madan Babu M, Madera M, Marchionni L, Matsuda H, Matsuzawa S, Miki H, Mignone F, Miyake S, Morris K, Mottagui-Tabar S, Mulder N, Nakano N, Nakauchi H, Ng P, Nilsson R, Nishiguchi S, Nishikawa S, Nori F, Ohara O, Okazaki Y, Orlando V, Pang KC, Pavan WJ, Pavesi G, Pesole G, Petrovsky N, Piazza S, Reed J, Reid JF, Ring BZ, Ringwald M, Rost B, Ruan Y, Salzberg SL, Sandelin A, Schneider C, Schonbach C, Sekiguchi K, Semple CA, Seno S, Sessa L, Sheng Y, Shibata Y, Shimada H, Shimada K, Silva D, Sinclair B, Sperling S, Stupka E, Sugiura K, Sultana R, Takenaka Y, Taki K, Tammoja K, Tan SL, Tang S, Taylor MS, Tegner J, Teichmann SA, Ueda HR, van Nimwegen E, Verardo R, Wei CL, Yagi K, Yamanishi H, Zabarovsky E, Zhu S, Zimmer A, Hide W, Bult C, Grimmond SM, Teasdale RD, Liu ET, Brusic V, Quackenbush J, Wahlestedt C, Mattick JS, Hume DA, Kai C, Sasaki D, Tomaru Y, Fukuda S, Kanamori-Katayama M, Suzuki M, Aoki J, Arakawa T, Iida J, Imamura K, Itoh M, Kato T, Kawaji H, Kawagashira N, Kawashima T, Kojima M, Kondo S, Konno H, Nakano K, Ninomiya N, Nishio T, Okada M, Plessy C, Shibata K, Shiraki T, Suzuki S, Tagami M, Waki K, Watahiki A, Okamura-Oho Y, Suzuki H, Kawai J, Hayashizaki Y, The transcriptional landscape of the mammalian genome. Science. 2005 Sep 2;309(5740):1559-63.
[PubMed ID: 16141073] ... Katayama S, Tomaru Y, Kasukawa T, Waki K, Nakanishi M, Nakamura M, Nishida H, Yap CC, Suzuki M, Kawai J, Suzuki H, Carninci P, Hayashizaki Y, Wells C, Frith M, Ravasi T, Pang KC, Hallinan J, Mattick J, Hume DA, Lipovich L, Batalov S, Engstrom PG, Mizuno Y, Faghihi MA, Sandelin A, Chalk AM, Mottagui-Tabar S, Liang Z, Lenhard B, Wahlestedt C, Antisense transcription in the mammalian transcriptome. Science. 2005 Sep 2;309(5740):1564-6.