CaMPDB :: Substrate

SB0030 : von Willebrand factor

* Basic Information

Organism	Mus musculus (house mouse)
Protein Names	von Willebrand factor precursor [Mus musculus]; von Willebrand factor precursor; vwf; von Willebrand factor; vWF; von Willebrand antigen 2; von Willebrand antigen II
Gene Names	Vwf; Vwf {ECO:0000312\|MGI:MGI:98941}; Von Willebrand factor homolog
Gene Locus	6 59.32 cM; chromosome 6
GO Function	Not available

Entrez Protein	Entrez Nucleotide	Entrez Gene	UniProt	OMIM	HGNC	HPRD	KEGG
NP_035838	NM_011708	22371	Q8CIZ8	N/A	N/A	N/A	mmu:22371

* Information From OMIM

Not Available.

* Structure Information

1. Primary Information

Length: 2813 aa

Average Mass: 309.154 kDa

Monoisotopic Mass: 308.951 kDa

2. Domain Information

Annotated Domains: interpro / pfam / smart / prosite

Computationally Assigned Domains (Pfam+HMMER):

domain name	begin	end	score	e-value
von Willebrand factor type D domain 1.	35	179	1.0	0.2
Trypsin Inhibitor like cysteine rich domain 1.	237	266	18.0	9.5
C8 domain 1.	317	331	32.0	4.1
Trypsin Inhibitor like cysteine rich domain 2.	367	384	31.0	4.2
Pacifastin inhibitor (LCMII) 1.	432	442	17.0	0.1
Trypsin Inhibitor like cysteine rich domain 3.	607	623	26.0	7.3
von Willebrand factor type C domain 1.	651	651	40.0	26.3
Trypsin Inhibitor like cysteine rich domain 4.	652	707	1.0	16.1
Trypsin Inhibitor like cysteine rich domain 5.	728	736	34.0	0.5
--- cleavage 763 ---
von Willebrand factor type C domain 2.	791	822	23.0	9.0
VWA N-terminal 1.	846	858	25.0	4.8
DHH family 1.	863	986	12.0	0.0
VWA N-terminal 2.	1098	1119	27.0	3.4
Trypsin Inhibitor like cysteine rich domain 6.	1124	1137	12.0	13.6
von Willebrand factor type C domain 3.	1142	1180	12.0	17.1
C8 domain 2.	1223	1241	42.0	2.6
DHH family 2.	1303	1364	30.0	0.0
von Willebrand factor type A domain 1.	1498	1644	1.0	0.0
von Willebrand factor type A domain 2.	1691	1858	1.0	0.1
Pacifastin inhibitor (LCMII) 2.	1889	1909	4.0	0.0
--- cleavage 1913 ---
Trypsin Inhibitor like cysteine rich domain 7.	1917	1951	8.0	8.1
von Willebrand factor type C domain 4.	2184	2184	41.0	23.6
VWA N-terminal 3.	2211	2227	24.0	2.4
VWA N-terminal 4.	2274	2297	21.0	9.7
VWA N-terminal 5.	2386	2397	65.0	9.6
Pacifastin inhibitor (LCMII) 3.	2419	2427	24.0	5.7
Trypsin Inhibitor like cysteine rich domain 8.	2448	2491	14.0	13.4
C8 domain 3.	2558	2580	24.0	7.3
C8 domain 4.	2605	2623	43.0	2.3
von Willebrand factor type C domain 5.	2665	2719	12.0	4.5
von Willebrand factor type C domain 6.	2788	2788	24.0	13.0

3. Sequence Information

Fasta Sequence: SB0030.fasta

Amino Acid Sequence and Secondary Structures (PsiPred):

4. 3D Information

Known Structures in PDB: 1U0O (X-ray; 270 A; C=1261-1468)

* Cleavage Information

2 [sites] cleaved by Calpain 2

Source Reference: [PubMed ID: 2845608] Nozaki H, Amino acid analysis of human von Willebrand factor fragments cleaved by porcine calpain II. Tokai J Exp Clin Med. 1987 Nov;12(4):223-7.

Cleavage sites (±10aa)

[Site 1] SSPLSHRSKR⁷⁶³-SLSCRPPMVK

Arg⁷⁶³ Ser

P10	P9	P8	P7	P6	P5	P4	P3	P2	P1

Ser⁷⁵⁴	Ser⁷⁵⁵	Pro⁷⁵⁶	Leu⁷⁵⁷	Ser⁷⁵⁸	His⁷⁵⁹	Arg⁷⁶⁰	Ser⁷⁶¹	Lys⁷⁶²	Arg⁷⁶³

P1'	P2'	P3'	P4'	P5'	P6'	P7'	P8'	P9'	P10'
Ser⁷⁶⁴	Leu⁷⁶⁵	Ser⁷⁶⁶	Cys⁷⁶⁷	Arg⁷⁶⁸	Pro⁷⁶⁹	Pro⁷⁷⁰	Met⁷⁷¹	Val⁷⁷²	Lys⁷⁷³

Sequence conservation (by blast) Sequence conservation (by blast)

Reference peptide (cleaved bond±30 residues)
GFMHCTTSGTLGSLLPDTVLSSPLSHRSKRSLSCRPPMVKLVCPADNPRAQGLECAKTCQ

Summary

#	organism	max score	hits	top seq
1	Mus musculus	124.00	4	VWF
2	Contains: von Willebrand antigen 2 (von Willebrand antigen II)	124.00	1	VWF_MOUSE von Willebrand factor precursor (vWF)
3	N/A	113.00	3	VWF_CANFA von Willebrand factor precursor (vWF)
4	Canis lupus familiaris	113.00	1	von Willebrand factor
5	Canis familiaris	113.00	1	von Willebrand factor
6	Homo sapiens	109.00	2	unnamed protein product
7	Contains: von Willebrand antigen 2 (von Willebrand antigen II)	109.00	1	VWF_HUMAN von Willebrand factor precursor (vWF)
8	Sus scrofa	107.00	1	VWF_PIG von Willebrand factor precursor (vWF) gi
9	Sus scrofa	106.00	1	von Willebrand factor; vWF
10	Bos taurus	105.00	1	VWF_BOVIN von Willebrand factor precursor (vWF) g
11	Oryctolagus cuniculus	95.50	1	von Willebrand factor; vWF

Top-ranked sequences

organism	matching
Mus musculus	Query 734 GFMHCTTSGTLGSLLPDTVLSSPLSHRSKR#SLSCRPPMVKLVCPADNPRAQGLECAKTCQ 793 \|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|#\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\| Query 734 GFMHCTTSGTLGSLLPDTVLSSPLSHRSKR#SLSCRPPMVKLVCPADNPRAQGLECAKTCQ 793
Contains: von Willebrand antigen 2 (von Willebrand antigen II)	Query 734 GFMHCTTSGTLGSLLPDTVLSSPLSHRSKR#SLSCRPPMVKLVCPADNPRAQGLECAKTCQ 793 \|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|#\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\| Query 734 GFMHCTTSGTLGSLLPDTVLSSPLSHRSKR#SLSCRPPMVKLVCPADNPRAQGLECAKTCQ 793
N/A	Query 734 GFMHCTTSGTLGSLLPDTVLSSPLSHRSKR#SLSCRPPMVKLVCPADNPRAQGLECAKTCQ 793 \|\|\|\|\|\|\|\|\| \|\|\|\|\|\|+ \|\|\|\|\| \|\|\|\|\|\|#\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|+\|\|\|\|\|\|\|\|\| Sbjct 734 GFMHCTTSGGLGSLLPNPVLSSPRSHRSKR#SLSCRPPMVKLVCPADNPRAEGLECAKTCQ 793
Canis lupus familiaris	Query 734 GFMHCTTSGTLGSLLPDTVLSSPLSHRSKR#SLSCRPPMVKLVCPADNPRAQGLECAKTCQ 793 \|\|\|\|\|\|\|\|\| \|\|\|\|\|\|+ \|\|\|\|\| \|\|\|\|\|\|#\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|+\|\|\|\|\|\|\|\|\| Sbjct 734 GFMHCTTSGGLGSLLPNPVLSSPRSHRSKR#SLSCRPPMVKLVCPADNPRAEGLECAKTCQ 793
Canis familiaris	Query 734 GFMHCTTSGTLGSLLPDTVLSSPLSHRSKR#SLSCRPPMVKLVCPADNPRAQGLECAKTCQ 793 \|\|\|\|\|\|\|\|\| \|\|\|\|\|\|+ \|\|\|\|\| \|\|\|\|\|\|#\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|+\|\|\|\|\|\|\|\|\| Sbjct 734 GFMHCTTSGGLGSLLPNPVLSSPRSHRSKR#SLSCRPPMVKLVCPADNPRAEGLECAKTCQ 793
Homo sapiens	Query 734 GFMHCTTSGTLGSLLPDTVLSSPLSHRSKR#SLSCRPPMVKLVCPADNPRAQGLECAKTCQ 793 \|\|\|\|\|\| \|\| \|\|\|\|\|\| \|\|\|\|\|\|\|\|\|\|\|\|#\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\| \|\|+\|\|\|\| \|\|\|\| Sbjct 734 GFMHCTMSGVPGSLLPDAVLSSPLSHRSKR#SLSCRPPMVKLVCPADNLRAEGLECTKTCQ 793
Contains: von Willebrand antigen 2 (von Willebrand antigen II)	Query 734 GFMHCTTSGTLGSLLPDTVLSSPLSHRSKR#SLSCRPPMVKLVCPADNPRAQGLECAKTCQ 793 \|\|\|\|\|\| \|\| \|\|\|\|\|\| \|\|\|\|\|\|\|\|\|\|\|\|#\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\| \|\|+\|\|\|\| \|\|\|\| Sbjct 734 GFMHCTMSGVPGSLLPDAVLSSPLSHRSKR#SLSCRPPMVKLVCPADNLRAEGLECTKTCQ 793
Sus scrofa	Query 734 GFMHCTTSGTLGSLLPDTVLSSPLSHRSKR#SLSCRPPMVKLVCPADNPRAQGLECAKTCQ 793 \|\|\|\|\|+ +\| \|\|\| \|+ \|\|\|\|\|\|\|\|\|\|\|\|#\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|+\|\|\|\|\|\|\|\|\| Sbjct 408 GFMHCSRAGAPGSLQPEVVLSSPLSHRSKR#SLSCRPPMVKLVCPADNPRAEGLECAKTCQ 467
Sus scrofa	Query 734 GFMHCTTSGTLGSLLPDTVLSSPLSHRSKR#SLSCRPPMVKLVCPADNPRAQGLECAKTCQ 793 \|\|\|\|\|+ +\| \|\|\| \|+ \|\|\|\|\|\|\|\|\|\|\|\|#\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|+\|\|\|\|\|\|\|\|\| Sbjct 12 GFMHCSRAGAPGSLQPEVVLSSPLSHRSKR#SLSCRPPMVKLVCPADNPRAEGLECAKTCQ 71
Bos taurus	Query 734 GFMHCTTSGTLGSLLPDTVLSSPLSHRSKR#SLSCRPPMVKLVCPADNPRAQGLECAKTCQ 793 \|\|\|\| \|\|\| \|\|\|\|\|+ \|\|\|\|\|\|\|\|\|\|\|\|#\|\|\|\|\|\|\|\|\|\|+\|\|\|\|\|\|\|\|\|+\|\|\|\| \|\|\|\| Sbjct 733 GFMHSATSGAPGSLLPEAVLSSPLSHRSKR#SLSCRPPMVKVVCPADNPRAEGLECTKTCQ 792
Oryctolagus cuniculus	Query 734 GFMHCTTSGTLGSLLPDTVLSSPLSHRSKR#SLSCRPPMVKLVCPADNPRAQGLECAKTCQ 793 \|\|\|\|\|\|+\|\| \|\|\|\|\|\|\| \| \|\|\|\|\|#\|\|\|\|\|\|\|\|\|\| \|\|\| \|\|\|\|\|+\|\|\|\|\|\|\|\|\| Sbjct 12 GFMHCTSSGRPGSLLPDTALP----HRSKR#SLSCRPPMVKFVCPHDNPRAEGLECAKTCQ 67

[Site 2] CLANGQTLLQ¹⁹¹³-SHRVNCDHGP

Gln¹⁹¹³ Ser

P10	P9	P8	P7	P6	P5	P4	P3	P2	P1

Cys¹⁹⁰⁴	Leu¹⁹⁰⁵	Ala¹⁹⁰⁶	Asn¹⁹⁰⁷	Gly¹⁹⁰⁸	Gln¹⁹⁰⁹	Thr¹⁹¹⁰	Leu¹⁹¹¹	Leu¹⁹¹²	Gln¹⁹¹³

P1'	P2'	P3'	P4'	P5'	P6'	P7'	P8'	P9'	P10'
Ser¹⁹¹⁴	His¹⁹¹⁵	Arg¹⁹¹⁶	Val¹⁹¹⁷	Asn¹⁹¹⁸	Cys¹⁹¹⁹	Asp¹⁹²⁰	His¹⁹²¹	Gly¹⁹²²	Pro¹⁹²³

Sequence conservation (by blast) Sequence conservation (by blast)

Reference peptide (cleaved bond±30 residues)
GNEKRPGDVWTLPDQCHTVTCLANGQTLLQSHRVNCDHGPRPSCANSQSPVRVEETCGCR

Summary

#	organism	max score	hits	top seq
1	Mus musculus	128.00	3	VWF
2	Contains: von Willebrand antigen 2 (von Willebrand antigen II)	128.00	1	VWF_MOUSE von Willebrand factor precursor (vWF)
3	N/A	114.00	5	VWF_CANFA von Willebrand factor precursor (vWF)
4	Canis lupus familiaris	114.00	1	von Willebrand factor
5	Canis familiaris	114.00	1	von Willebrand factor
6	Contains: von Willebrand antigen 2 (von Willebrand antigen II)	111.00	1	VWF_HUMAN von Willebrand factor precursor (vWF)
7	Homo sapiens	110.00	3	unnamed protein product
8	Bos taurus	107.00	1	von Willebrand factor
9	Sus scrofa	102.00	1	VWF_PIG von Willebrand factor precursor (vWF) gi
10	Tetraodon nigroviridis	70.10	1	unnamed protein product
11	Oryza sativa Japonica Group	31.60	1	OJ1005_B10.1

Top-ranked sequences

organism	matching
Mus musculus	Query 1884 GNEKRPGDVWTLPDQCHTVTCLANGQTLLQ#SHRVNCDHGPRPSCANSQSPVRVEETCGCR 1943 \|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|#\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\| Query 1884 GNEKRPGDVWTLPDQCHTVTCLANGQTLLQ#SHRVNCDHGPRPSCANSQSPVRVEETCGCR 1943
Contains: von Willebrand antigen 2 (von Willebrand antigen II)	Query 1884 GNEKRPGDVWTLPDQCHTVTCLANGQTLLQ#SHRVNCDHGPRPSCANSQSPVRVEETCGCR 1943 \|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|#\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\| Query 1884 GNEKRPGDVWTLPDQCHTVTCLANGQTLLQ#SHRVNCDHGPRPSCANSQSPVRVEETCGCR 1943
N/A	Query 1884 GNEKRPGDVWTLPDQCHTVTCLANGQTLLQ#SHRVNCDHGPRPSCANSQSPVRVEETCGCR 1943 \|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\| +\|\|\|\|\|+#\|\|\|\|\|\|\| \|\|\|\|\|\| \| \| \|+\|\|\|\|\|\|\|\|\| Sbjct 1884 GNEKRPGDVWTLPDQCHTVTCLPDGQTLLK#SHRVNCDRGPRPSCPNGQPPLRVEETCGCR 1943
Canis lupus familiaris	Query 1884 GNEKRPGDVWTLPDQCHTVTCLANGQTLLQ#SHRVNCDHGPRPSCANSQSPVRVEETCGCR 1943 \|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\| +\|\|\|\|\|+#\|\|\|\|\|\|\| \|\|\|\|\|\| \| \| \|+\|\|\|\|\|\|\|\|\| Sbjct 1884 GNEKRPGDVWTLPDQCHTVTCLPDGQTLLK#SHRVNCDRGPRPSCPNGQPPLRVEETCGCR 1943
Canis familiaris	Query 1884 GNEKRPGDVWTLPDQCHTVTCLANGQTLLQ#SHRVNCDHGPRPSCANSQSPVRVEETCGCR 1943 \|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\| +\|\|\|\|\|+#\|\|\|\|\|\|\| \|\|\|\|\|\| \| \| \|+\|\|\|\|\|\|\|\|\| Sbjct 1884 GNEKRPGDVWTLPDQCHTVTCLPDGQTLLK#SHRVNCDRGPRPSCPNGQPPLRVEETCGCR 1943
Contains: von Willebrand antigen 2 (von Willebrand antigen II)	Query 1884 GNEKRPGDVWTLPDQCHTVTCLANGQTLLQ#SHRVNCDHGPRPSCANSQSPVRVEETCGCR 1943 \|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\| +\|\|\|\|\|+#\|\|\|\|\|\|\| \| \|\|\|\| \|\|\|\|\|\|+\|\|\|\|\|\|\|\| Sbjct 1884 GNEKRPGDVWTLPDQCHTVTCQPDGQTLLK#SHRVNCDRGLRPSCPNSQSPVKVEETCGCR 1943
Homo sapiens	Query 1884 GNEKRPGDVWTLPDQCHTVTCLANGQTLLQ#SHRVNCDHGPRPSCANSQSPVRVEETCGCR 1943 \|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\| +\|\|\|\|\|+#+\|\|\|\|\|\| \| \|\|\|\| \|\|\|\|\|\|+\|\|\|\|\|\|\|\| Sbjct 1884 GNEKRPGDVWTLPDQCHTVTCQPDGQTLLK#THRVNCDRGLRPSCPNSQSPVKVEETCGCR 1943
Bos taurus	Query 1884 GNEKRPGDVWTLPDQCHTVTCLANGQTLLQ#SHRVNCDHGPRPSCANSQSPVRVEETCGCR 1943 \|\|\|+\|\|\|\|\|\|\|\| \|\|\|\|\|\|\|\|\| +\|\|\|\|\|+#\|\|\|\|\|\|\| \|\|+\|\|\| + \|+\|+\|+\|\| \|\|\|\| Sbjct 413 GNERRPGDVWTLLDQCHTVTCLPDGQTLLK#SHRVNCDQGPQPSCPDGQTPLRMEEACGCR 472
Sus scrofa	Query 1884 GNEKRPGDVWTLPDQCHTVTCLANGQTLLQ#SHRVNCDHGPRPSCANSQSPVRVEETCGCR 1943 \|+\|++\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\| +\|\|\|\|\|+#\|\|\|\|\|\|\| \| +\|\|\| ++\| \|+\|\|\|\| \|\|\|\| Sbjct 1553 GSERKPGDVWTLPDQCHTVTCLPDGQTLLK#SHRVNCDQGLQPSCPSNQPPIRVEEACGCR 1612
Tetraodon nigroviridis	Query 1884 GNEKRPGDVWTLPDQCHTVTCLANGQTLLQ#SHRVNCDHGPRPSCANSQSPVRVEETCGCR 1943 \|\|\|++\|\|\| \| \| \| \|\|+\| \| +\| +\|#+ +\|+\|\| \|\|\|+\|+ \|\|\|\|++\|\| \|\| Sbjct 2001 GNERKPGDTWLLEDGCHSVLCHPSGAVTVQ#TRKVSCDTQELPSCSNNMPPVRVQDTCNCR 2060
Oryza sativa Japonica Group	Query 1884 GNEKRPGDVWTLPDQCHT 1901 \| \|\|\|\| +\|\|\|+\|\| \| \| Sbjct 62 GREKRPEEVWTVPDDCST 79

* References

[PubMed ID: 24850761] Yee A, Gildersleeve RD, Gu S, Kretz CA, McGee BM, Carr KM, Pipe SW, Ginsburg D, A von Willebrand factor fragment containing the D'D3 domains is sufficient to stabilize coagulation factor VIII in mice. Blood. 2014 Jul 17;124(3):445-52. doi: 10.1182/blood-2013-11-540534. Epub 2014

» More (9) « Hide Below

[PubMed ID: 24713928] ... Morioka Y, Casari C, Wohner N, Cho S, Kurata S, Kitano A, Christophe OD, Lenting PJ, Li R, Denis CV, Prevost N, Expression of a structurally constrained von Willebrand factor variant triggers acute thrombotic thrombocytopenic purpura in mice. Blood. 2014 May 22;123(21):3344-53. doi: 10.1182/blood-2013-10-531392. Epub 2014

[PubMed ID: 24805242] ... van Berlo JH, Kanisicak O, Maillet M, Vagnozzi RJ, Karch J, Lin SC, Middleton RC, Marban E, Molkentin JD, c-kit+ cells minimally contribute cardiomyocytes to the heart. Nature. 2014 May 15;509(7500):337-41. doi: 10.1038/nature13309. Epub 2014 May 7.

[PubMed ID: 24733925] ... Dmitrieva NI, Burg MB, Secretion of von Willebrand factor by endothelial cells links sodium to hypercoagulability and thrombosis. Proc Natl Acad Sci U S A. 2014 Apr 29;111(17):6485-90. doi:

[PubMed ID: 24642750] ... Da Q, Behymer M, Correa JI, Vijayan KV, Cruz MA, Platelet adhesion involves a novel interaction between vimentin and von Willebrand factor under high shear stress. Blood. 2014 Apr 24;123(17):2715-21. doi: 10.1182/blood-2013-10-530428. Epub 2014

[PubMed ID: 7490564] ... Chakraborty I, Das SK, Dey SK, Differential expression of vascular endothelial growth factor and its receptor mRNAs in the mouse uterus around the time of implantation. J Endocrinol. 1995 Nov;147(2):339-52.

[PubMed ID: 7502236] ... Schatteman GC, Motley ST, Effmann EL, Bowen-Pope DF, Platelet-derived growth factor receptor alpha subunit deleted Patch mouse exhibits severe cardiovascular dysmorphogenesis. Teratology. 1995 Jun;51(6):351-66.

[PubMed ID: 1630810] ... Dumont DJ, Yamaguchi TP, Conlon RA, Rossant J, Breitman ML, tek, a novel tyrosine kinase gene located on mouse chromosome 4, is expressed in endothelial cells and their presumptive precursors. Oncogene. 1992 Aug;7(8):1471-80.

[PubMed ID: 1317267] ... Lee KF, Li E, Huber LJ, Landis SC, Sharpe AH, Chao MV, Jaenisch R, Targeted mutation of the gene encoding the low affinity NGF receptor p75 leads to deficits in the peripheral sensory nervous system. Cell. 1992 May 29;69(5):737-49.

[PubMed ID: 1936575] ... Coffin JD, Harrison J, Schwartz S, Heimark R, Angioblast differentiation and morphogenesis of the vascular endothelium in the mouse embryo. Dev Biol. 1991 Nov;148(1):51-62.