CaMPDB :: Substrate

SB0033 : Myosin 5A, heavy chain 12

* Basic Information

Organism	Gallus gallus (chicken)
Protein Names	unconventional myosin-Va [Gallus gallus]; unconventional myosin-Va; dilute myosin heavy chain, non-muscle; myosin heavy chain P190; myosin 5A; myosin I heavy chain isoform; myosin-Va; myosin VA (heavy polypeptide 12, myoxin); myosin VA (heavy chain 12, myosin); myosin, heavy polypeptide kinase; Unconventional myosin-Va; Dilute myosin heavy chain, non-muscle; Myosin heavy chain p190; Myosin-V
Gene Names	MYO5A; myosin VA (heavy chain 12, myoxin)
Gene Locus	10; chromosome 10
GO Function	Not available

Entrez Protein	Entrez Nucleotide	Entrez Gene	UniProt	OMIM	HGNC	HPRD	KEGG
NP_990631	NM_205300	396237	Q02440	N/A	N/A	N/A	gga:396237

* Information From OMIM

Not Available.

* Structure Information

1. Primary Information

Length: 1829 aa

Average Mass: 212.380 kDa

Monoisotopic Mass: 212.248 kDa

2. Domain Information

Annotated Domains: interpro / pfam / smart / prosite

Computationally Assigned Domains (Pfam+HMMER):

domain name	begin	end	score	e-value
Myosin N-terminal SH3-like domain 1.	12	29	3.0	0.1
AAA ATPase domain 1.	146	179	15.0	0.0
Helix-turn-helix domain 1.	307	320	3.0	0.0
DIL domain 1.	781	823	24.0	0.2
IQ calmodulin-binding motif 1.	839	859	1.0	0.1
IQ calmodulin-binding motif 2.	867	884	4.0	0.2
Myosin head (motor domain) 1.	904	1064	204.0	7.4
--- cleavage 1140 ---
AAA ATPase domain 2.	1176	1216	95.0	0.4
AAA ATPase domain 3.	1348	1381	101.0	0.6
Helix-turn-helix domain 2.	1672	1706	15.0	0.0
Helix-turn-helix domain 3.	1723	1734	6.0	0.0

3. Sequence Information

Fasta Sequence: SB0033.fasta

Amino Acid Sequence and Secondary Structures (PsiPred):

4. 3D Information

Known Structures in PDB: 1OE9 (X-ray; 205 A; A=1-792), 1W7I (X-ray; 300 A; A=1-792), 1W7J (X-ray; 200 A; A=1-792), 1W8J (X-ray; 270 A; A/B/C/D=1-766), 2DFS (EM; 2400 A; A/M=1-1080)

* Cleavage Information

1 [sites] cleaved by Calpain 1 or 2

Source Reference: [PubMed ID: 8663447] Nascimento AA, Cheney RE, Tauhata SB, Larson RE, Mooseker MS, Enzymatic characterization and functional domain mapping of brain myosin-V. J Biol Chem. 1996 Jul 19;271(29):17561-9.

Cleavage sites (±10aa)

[Site 1] ITEAEDLPLR¹¹⁴⁰-MEEPSEKKAP

Arg¹¹⁴⁰ Met

iTraq-117 Signal 2381.1 () for MEEPSEKKAP

P10	P9	P8	P7	P6	P5	P4	P3	P2	P1

Ile¹¹³¹	Thr¹¹³²	Glu¹¹³³	Ala¹¹³⁴	Glu¹¹³⁵	Asp¹¹³⁶	Leu¹¹³⁷	Pro¹¹³⁸	Leu¹¹³⁹	Arg¹¹⁴⁰

P1'	P2'	P3'	P4'	P5'	P6'	P7'	P8'	P9'	P10'
Met¹¹⁴¹	Glu¹¹⁴²	Glu¹¹⁴³	Pro¹¹⁴⁴	Ser¹¹⁴⁵	Glu¹¹⁴⁶	Lys¹¹⁴⁷	Lys¹¹⁴⁸	Ala¹¹⁴⁹	Pro¹¹⁵⁰

Sequence conservation (by blast) Sequence conservation (by blast)

Reference peptide (cleaved bond±30 residues)
HKRTDSTHSSNESEYTFSSEITEAEDLPLRMEEPSEKKAPLDMSLFLKLQKRVTELEQEK

Summary

#	organism	max score	hits	top seq
1	Gallus gallus	121.00	2	myosin VA
2	Canis familiaris	112.00	2	PREDICTED: similar to Myosin-5A (Myosin Va) (Dilu
3	Sus scrofa	109.00	2	myosin Va
4	Homo sapiens	107.00	9	mysoin heavy chain 12
5	Mus musculus	101.00	5	MYO5A_MOUSE Myosin-Va (Dilute myosin heavy chain,
6	N/A	101.00	2	1705299A myosin H
7	Rattus norvegicus	100.00	2	myosin Va
8	Tetraodon nigroviridis	53.90	1	unnamed protein product
9	Strongylocentrotus purpuratus	41.20	1	myosin V

Top-ranked sequences

organism	matching
Gallus gallus	Query 1111 HKRTDSTHSSNESEYTFSSEITEAEDLPLR#MEEPSEKKAPLDMSLFLKLQKRVTELEQEK 1170 \|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|#\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\| Query 1111 HKRTDSTHSSNESEYTFSSEITEAEDLPLR#MEEPSEKKAPLDMSLFLKLQKRVTELEQEK 1170
Canis familiaris	Query 1111 HKRTDSTHSSNESEYTFSSEITEAEDLPLR#MEEPSEKKAPLDMSLFLKLQKRVTELEQEK 1170 \|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\| \| \|\|+\|\|\|# \|\|\|\|\|\|\| \|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\| Sbjct 1187 HKRTDSTHSSNESEYTFSSEIAETEDMPLR#TEEPSEKKVPLDMSLFLKLQKRVTELEQEK 1246
Sus scrofa	Query 1111 HKRTDSTHSSNESEYTFSSEITEAEDLPLR#MEEPSEKKAPLDMSLFLKLQKRVTELEQEK 1170 \|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\| \| \|\|+\| \|# \|\|\|\|\|\|\| \|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\| Sbjct 1109 HKRTDSTHSSNESEYTFSSEIAETEDIPSR#TEEPSEKKVPLDMSLFLKLQKRVTELEQEK 1168
Homo sapiens	Query 1111 HKRTDSTHSSNESEYTFSSEITEAEDLPLR#MEEPSEKKAPLDMSLFLKLQKRVTELEQEK 1170 \|\|\|\|\|\|\|\|\|\|\|\|\|\|\| \|\|\|\|\| \| \|\|+\| \|# \|\|\|\|\|\|\| \|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\| Sbjct 1110 HKRTDSTHSSNESEYIFSSEIAEMEDIPSR#TEEPSEKKVPLDMSLFLKLQKRVTELEQEK 1169
Mus musculus	Query 1111 HKRTDSTHSSNESEYTFSSEITEAEDLPLR#MEEPSEKKAPLDMSLFLKLQKRVTELEQEK 1170 \|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\| \| \|\|+ \|# \|\|\| \|\|\| \|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\| Sbjct 1110 HKRTDSTHSSNESEYTFSSEFAETEDIAPR#TEEPIEKKVPLDMSLFLKLQKRVTELEQEK 1169
N/A	Query 1111 HKRTDSTHSSNESEYTFSSEITEAEDLPLR#MEEPSEKKAPLDMSLFLKLQKRVTELEQEK 1170 \|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\| \| \|\|+ \|# \|\|\| \|\|\| \|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\| Sbjct 1109 HKRTDSTHSSNESEYTFSSEFAETEDIAPR#TEEPIEKKVPLDMSLFLKLQKRVTELEQEK 1168
Rattus norvegicus	Query 1111 HKRTDSTHSSNESEYTFSSEITEAEDLPLR#MEEPSEKKAPLDMSLFLKLQKRVTELEQEK 1170 \|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\| \| \|\|+ \|# \|\|\|+\|\|\| \|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\| \|\|\| Sbjct 1110 HKRTDSTHSSNESEYTFSSEFAETEDIAPR#TEEPTEKKVPLDMSLFLKLQKRVTELGQEK 1169
Tetraodon nigroviridis	Query 1111 HKRTDSTHSSNESEYTF----SSEITEAEDLPLR#MEEPSEKKAPLDMSLFLKLQKRVTEL 1166 \|+\|\| \| \|\| \|+ + +\|\|+ + \|\| +#+\|\| +\|\| +\|+\|\|\|+\|\|\|\|\|\| \|\| Sbjct 994 HRRTTSNQSSIGSDSNYPSFSTSEVGDTEDAIQQ#VEEMGLEKAAMDISLFMKLQKRVREL 1053 Query 1167 EQEK 1170 \|\|\|+ Sbjct 1054 EQER 1057
Strongylocentrotus purpuratus	Query 1111 HKRTDSTHSSNESEYTFSSEITE-AEDLPLR#MEEPSEKKAPLDMSLFLKLQKRVTELEQE 1169 \| \| \|\|+ + \| ++ \|\| \|\|++ # \|\| \|+ \| +\|+\|+\|+\|\|\|+\| +\|\|+\| Sbjct 1099 HVRADSSEGAESGYGTLATTTTEDAENV---#-EEQGEENASMDISVFIKLQQRCRDLEKE 1154 Query 1170 K 1170 \| Query 1170 K 1170

* References

[PubMed ID: 24302658] Kanno TY, Espreafico EM, Yan CY, Role of myosin Va in neuritogenesis of chick dorsal root ganglia nociceptive neurons. Cell Biol Int. 2014 Mar;38(3):388-94. doi: 10.1002/cbin.10210. Epub 2013 Dec 3.

» More (9) « Hide Below

[PubMed ID: 22713570] ... Trivedi DV, David C, Jacobs DJ, Yengo CM, Switch II mutants reveal coupling between the nucleotide- and actin-binding regions in myosin V. Biophys J. 2012 Jun 6;102(11):2545-55. doi: 10.1016/j.bpj.2012.04.025. Epub 2012

[PubMed ID: 21640122] ... Purcell TJ, Naber N, Sutton S, Cooke R, Pate E, EPR spectra and molecular dynamics agree that the nucleotide pocket of myosin V is closed and that it opens on binding actin. J Mol Biol. 2011 Aug 5;411(1):16-26. doi: 10.1016/j.jmb.2011.05.019. Epub 2011

[PubMed ID: 20974847] ... Lu H, Kennedy GG, Warshaw DM, Trybus KM, Simultaneous observation of tail and head movements of myosin V during processive motion. J Biol Chem. 2010 Dec 31;285(53):42068-74. doi: 10.1074/jbc.M110.180265. Epub

[PubMed ID: 20935627] ... Kodera N, Yamamoto D, Ishikawa R, Ando T, Video imaging of walking myosin V by high-speed atomic force microscopy. Nature. 2010 Nov 4;468(7320):72-6. doi: 10.1038/nature09450. Epub 2010 Oct 10.

[PubMed ID: 14992598] ... Yengo CM, Sweeney HL, Functional role of loop 2 in myosin V. Biochemistry. 2004 Mar 9;43(9):2605-12.

[PubMed ID: 14565972] ... Cao TT, Chang W, Masters SE, Mooseker MS, Myosin-Va binds to and mechanochemically couples microtubules to actin filaments. Mol Biol Cell. 2004 Jan;15(1):151-61. Epub 2003 Oct 17.

[PubMed ID: 10519557] ... Wells AL, Lin AW, Chen LQ, Safer D, Cain SM, Hasson T, Carragher BO, Milligan RA, Sweeney HL, Myosin VI is an actin-based motor that moves backwards. Nature. 1999 Sep 30;401(6752):505-8.

[PubMed ID: 1469047] ... Espreafico EM, Cheney RE, Matteoli M, Nascimento AA, De Camilli PV, Larson RE, Mooseker MS, Primary structure and cellular localization of chicken brain myosin-V (p190), an unconventional myosin with calmodulin light chains. J Cell Biol. 1992 Dec;119(6):1541-57.

[PubMed ID: 1383040] ... Sanders G, Lichte B, Meyer HE, Kilimann MW, cDNA encoding the chicken ortholog of the mouse dilute gene product. Sequence comparison reveals a myosin I subfamily with conserved C-terminal domains. FEBS Lett. 1992 Oct 26;311(3):295-8.