CaMPDB :: Substrate

SB0084 : BID, BH3 interacting domain death agonist

* Basic Information

Organism	Homo sapiens (human)
Protein Names	BH3-interacting domain death agonist isoform 2 [Homo sapiens]; BH3-interacting domain death agonist isoform 2; BH3-interacting domain death agonist; apoptic death agonist; Human BID coding sequence; desmocollin type 4; BID isoform ES(1b); BID isoform L(2); BID isoform Si6; p22 BID; BID; BH3-interacting domain death agonist p15; p15 BID; BH3-interacting domain death agonist p13; p13 BID; BH3-interacting domain death agonist p11; p11 BID
Gene Names	BID; BH3 interacting domain death agonist
Gene Locus	22q11.1; chromosome 22
GO Function	Not available

Entrez Protein	Entrez Nucleotide	Entrez Gene	UniProt	OMIM	HGNC	HPRD	KEGG
NP_001187	NM_001196	637	P55957	601997	HGNC:1050	03590	hsa:637

* Information From OMIM

Function: Luo et al. (1998) reported the purification of a cytosolic protein that induces cytochrome c release from mitochondria in response to caspase-8 (CASP8; OMIM:601763), the apical caspase activated by cell surface death receptors such as FAS (OMIM:134637) and TNF (OMIM:191160). Peptide mass fingerprinting identified this protein as BID. CASP8 cleaves BID, and the COOH-terminal part translocates to mitochondria where it triggers cytochrome c release. Immunodepletion of BID from cell extracts eliminated the cytochrome c releasing activity. The cytochrome c releasing activity of BID was antagonized by BCL2. A mutation at the BH3 domain diminished its cytochrome c releasing activity. BID, therefore, relays an apoptotic signal from the cell surface to mitochondria.

* Structure Information

1. Primary Information

Length: 195 aa

Average Mass: 21.994 kDa

Monoisotopic Mass: 21.981 kDa

2. Domain Information

Annotated Domains: interpro / pfam / smart / prosite

Computationally Assigned Domains (Pfam+HMMER):

domain name	begin	end	score	e-value
Apoptosis regulator proteins, Bcl-2 family 1.	55	94	6.0	0.0
--- cleavage 70 (inside Apoptosis regulator proteins, Bcl-2 family 55..94) ---
CRM1 C terminal 1.	131	185	73.0	0.0

3. Sequence Information

Fasta Sequence: SB0084.fasta

Amino Acid Sequence and Secondary Structures (PsiPred):

4. 3D Information

Known Structures in PDB: 1ZY3 (NMR; -; B=82-101), 2BID (NMR; -; A=1-195), 2KBW (NMR; -; B=76-106), 2M5B (NMR; -; B=80-101), 2M5I (NMR; -; A=61-195), 4BD2 (X-ray; 221 A; C=76-109), 4ZEQ (X-ray; 180 A; B=79-104), 5AJJ (X-ray; 175 A; B=79-112)

* Cleavage Information

1 [sites] cleaved by Calpain 2

Source Reference: [PubMed ID: 11940658] Mandic A, Viktorsson K, Strandberg L, Heiden T, Hansson J, Linder S, Shoshan MC, Calpain-mediated Bid cleavage and calpain-independent Bak modulation: two separate pathways in cisplatin-induced apoptosis. Mol Cell Biol. 2002 May;22(9):3003-13.

Cleavage sites (±10aa)

[Site 1] GNRSSHSRLG⁷⁰-RIEADSESQE

Gly⁷⁰ Arg

P10	P9	P8	P7	P6	P5	P4	P3	P2	P1

Gly⁶¹	Asn⁶²	Arg⁶³	Ser⁶⁴	Ser⁶⁵	His⁶⁶	Ser⁶⁷	Arg⁶⁸	Leu⁶⁹	Gly⁷⁰

P1'	P2'	P3'	P4'	P5'	P6'	P7'	P8'	P9'	P10'
Arg⁷¹	Ile⁷²	Glu⁷³	Ala⁷⁴	Asp⁷⁵	Ser⁷⁶	Glu⁷⁷	Ser⁷⁸	Gln⁷⁹	Glu⁸⁰

Sequence conservation (by blast) Sequence conservation (by blast)

Reference peptide (cleaved bond±30 residues)
GHELPVLAPQWEGYDELQTDGNRSSHSRLGRIEADSESQEDIIRNIARHLAQVGDSMDRS

Summary

#	organism	max score	hits	top seq
1	Homo sapiens	126.00	4	BH3 interacting domain death agonist isoform 2
2	N/A	126.00	2	A Chain A, Human Pro-Apoptotic Protein Bid
3	synthetic construct	124.00	1	Homo sapiens enolase 1, (alpha)
4	Mus musculus	69.70	2	BID
5	Sus scrofa	67.00	2	BH3 interacting domain death agonist
6	Rattus norvegicus	65.10	2	BH3 interacting domain death agonist
7	Canis familiaris	55.50	1	PREDICTED: similar to BH3 interacting domain deat
8	Bos taurus	54.70	1	BH3 interacting domain death agonist
9	Gallus gallus	50.10	1	BH3 interacting domain death agonist

Top-ranked sequences

organism	matching
Homo sapiens	Query 41 GHELPVLAPQWEGYDELQTDGNRSSHSRLG#RIEADSESQEDIIRNIARHLAQVGDSMDRS 100 \|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|#\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\| Query 41 GHELPVLAPQWEGYDELQTDGNRSSHSRLG#RIEADSESQEDIIRNIARHLAQVGDSMDRS 100
N/A	Query 41 GHELPVLAPQWEGYDELQTDGNRSSHSRLG#RIEADSESQEDIIRNIARHLAQVGDSMDRS 100 \|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|#\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\| Query 41 GHELPVLAPQWEGYDELQTDGNRSSHSRLG#RIEADSESQEDIIRNIARHLAQVGDSMDRS 100
synthetic construct	Query 41 GHELPVLAPQWEGYDELQTDGNRSSHSRLG#RIEADSESQEDIIRNIARHLAQVGDSMDRS 100 \|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|#\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\| Query 41 GHELPVLAPQWEGYDELQTDGNRSSHSRLG#RIEADSESQEDIIRNIARHLAQVGDSMDRS 100
Mus musculus	Query 41 GHELPVLAPQWEG--YDELQTDGNRSSHS-RLG#RIEADSESQEDIIRNIARHLAQVGDSM 97 \| \|\|\|\| \| \|\| \|\|\|\|\|\|\|+++\| \| \|#\|\|\| \|\|\|\|\|\|+\|\| \|\|\|\|\|\|\|\|+\|\| \| Sbjct 39 GRELPVQA-YWEADLEDELQTDGSQASRSFNQG#RIEPDSESQEEIIHNIARHLAQIGDEM 97 Query 98 D 98 \| Query 98 D 98
Sus scrofa	Query 41 GHELPVLAPQWEGYDELQTDGNRSSHSRLG#RIEADSESQEDIIRNIARHLAQVGDSMD 98 \|\|\|\|\|\| \| \|\|\|\|\|\|\|\|\| \|+ # \| \|\|\|\|\|\| +\|\|+\|\|\|\|\|\|++\|\| \|+ Sbjct 41 GHELPV---HTSGSDELQTDGNRCSYFMED#AAETDSESQEAVIRDIARHLARIGDRME 95
Rattus norvegicus	Query 41 GHELPV-LAPQWEGYDELQTDGNRSSHSRL-G#RIEADSESQEDIIRNIARHLAQVGDSMD 98 \| \|\|\|\| + + + \|\|\|\|\|\|\|+\|+\| \| \|#\|\|\| \|\|\|\|\|+++\| \|\|\|\|\|\|\|\| \|\| +\| Sbjct 40 GQELPVQVYLEGDREDELQTDGSRASRSFYHG#RIEPDSESQDEVIHNIARHLAQAGDELD 99 Query 99 RS 100 \| Sbjct 100 HS 101
Canis familiaris	Query 45 PVLAPQWEGYD-ELQTDGNRSSHSRLG#RIEADSESQEDIIRNIARHLAQVGDSMDRS 100 \|\| \| \| +\| \|\|\|\|\|\|\|\| \|+ \|# + \|\|\|\|\|\|+\|\|++\|\|\| \|\|\|+\|\| \|\| \| Sbjct 125 PVPAYLKEDHDNELQTDGNRCSYFLDG#GVR-DSESQEEIIQDIARQLAQIGDRMDHS 180
Bos taurus	Query 41 GHELPVLAPQWEGY----DELQTDGNRSSHSRLG-#RIEADSESQEDIIRNIARHLAQVGD 95 \|\|\|\|\| \|+ \|\|\|\|\|\|\|\|\| \|\| \| # \| \|\|\| \|\|+ +\| +\|\| \|\|\|+\|\| Sbjct 41 GHELP-------GHLFHDDELQTDGNRCSHFPLAA#EAETDSERQEEAVREVARQLAQIGD 93 Query 96 SMDRS 100 ++ \| Sbjct 94 RLEGS 98
Gallus gallus	Query 56 ELQTDGNRSSHSRLG#RIEADSESQEDIIRNIARHLAQVGDSMDR 99 \|\|\|\|\|\|\|\|\| \| + \|# + \| \| \| \|+\| \|\| \|\|++\|\| +\|+ Sbjct 57 ELQTDGNRSGHLQNG#ELVPDPEVNEAIVRTIAAQLAEIGDQLDK 100

* References

[PubMed ID: 24158446] Wang Y, Tjandra N, Structural insights of tBid, the caspase-8-activated Bid, and its BH3 domain. J Biol Chem. 2013 Dec 13;288(50):35840-51. doi: 10.1074/jbc.M113.503680. Epub

» More (16) « Hide Below

[PubMed ID: 23851982] ... Kiyota M, Kuroda J, Yamamoto-Sugitani M, Shimura Y, Nakayama R, Nagoshi H, Mizutani S, Chinen Y, Sasaki N, Sakamoto N, Kobayashi T, Matsumoto Y, Horiike S, Taniwaki M, FTY720 induces apoptosis of chronic myelogenous leukemia cells via dual activation of BIM and BID and overcomes various types of resistance to tyrosine kinase inhibitors. Apoptosis. 2013 Nov;18(11):1437-46. doi: 10.1007/s10495-013-0882-y.

[PubMed ID: 24074954] ... Sarosiek KA, Chi X, Bachman JA, Sims JJ, Montero J, Patel L, Flanagan A, Andrews DW, Sorger P, Letai A, BID preferentially activates BAK while BIM preferentially activates BAX, affecting chemotherapy response. Mol Cell. 2013 Sep 26;51(6):751-65. doi: 10.1016/j.molcel.2013.08.048.

[PubMed ID: 23744079] ... Shamas-Din A, Bindner S, Zhu W, Zaltsman Y, Campbell C, Gross A, Leber B, Andrews DW, Fradin C, tBid undergoes multiple conformational changes at the membrane required for Bax activation. J Biol Chem. 2013 Jul 26;288(30):22111-27. doi: 10.1074/jbc.M113.482109. Epub

[PubMed ID: 23604079] ... Moldoveanu T, Grace CR, Llambi F, Nourse A, Fitzgerald P, Gehring K, Kriwacki RW, Green DR, BID-induced structural changes in BAK promote apoptosis. Nat Struct Mol Biol. 2013 May;20(5):589-97. doi: 10.1038/nsmb.2563. Epub 2013 Apr

[PubMed ID: 17525332] ... Matsuoka S, Ballif BA, Smogorzewska A, McDonald ER 3rd, Hurov KE, Luo J, Bakalarski CE, Zhao Z, Solimini N, Lerenthal Y, Shiloh Y, Gygi SP, Elledge SJ, ATM and ATR substrate analysis reveals extensive protein networks responsive to DNA damage. Science. 2007 May 25;316(5828):1160-6.

[PubMed ID: 15592455] ... Rush J, Moritz A, Lee KA, Guo A, Goss VL, Spek EJ, Zhang H, Zha XM, Polakiewicz RD, Comb MJ, Immunoaffinity profiling of tyrosine phosphorylation in cancer cells. Nat Biotechnol. 2005 Jan;23(1):94-101. Epub 2004 Dec 12.

[PubMed ID: 12000759] ... Gil-Parrado S, Fernandez-Montalvan A, Assfalg-Machleidt I, Popp O, Bestvater F, Holloschi A, Knoch TA, Auerswald EA, Welsh K, Reed JC, Fritz H, Fuentes-Prior P, Spiess E, Salvesen GS, Machleidt W, Ionomycin-activated calpain triggers apoptosis. A probable role for Bcl-2 family members. J Biol Chem. 2002 Jul 26;277(30):27217-26. Epub 2002 May 8.

[PubMed ID: 11832478] ... Guo Y, Srinivasula SM, Druilhe A, Fernandes-Alnemri T, Alnemri ES, Caspase-2 induces apoptosis by releasing proapoptotic proteins from mitochondria. J Biol Chem. 2002 Apr 19;277(16):13430-7. Epub 2002 Feb 6.

[PubMed ID: 11583622] ... Desagher S, Osen-Sand A, Montessuit S, Magnenat E, Vilbois F, Hochmann A, Journot L, Antonsson B, Martinou JC, Phosphorylation of bid by casein kinases I and II regulates its cleavage by caspase 8. Mol Cell. 2001 Sep;8(3):601-11.

[PubMed ID: 11085743] ... Sutton VR, Davis JE, Cancilla M, Johnstone RW, Ruefli AA, Sedelies K, Browne KA, Trapani JA, Initiation of apoptosis by granzyme B requires direct cleavage of bid, but not direct granzyme B-mediated caspase activation. J Exp Med. 2000 Nov 20;192(10):1403-14.

[PubMed ID: 9727491] ... Luo X, Budihardjo I, Zou H, Slaughter C, Wang X, Bid, a Bcl2 interacting protein, mediates cytochrome c release from mitochondria in response to activation of cell surface death receptors. Cell. 1998 Aug 21;94(4):481-90.

[PubMed ID: 9721221] ... Footz TK, Birren B, Minoshima S, Asakawa S, Shimizu N, Riazi MA, McDermid HE, The gene for death agonist BID maps to the region of human 22q11.2 duplicated in cat eye syndrome chromosomes and to mouse chromosome 6. Genomics. 1998 Aug 1;51(3):472-5.

[PubMed ID: 9463381] ... Huang DC, Adams JM, Cory S, The conserved N-terminal BH4 domain of Bcl-2 homologues is essential for inhibition of apoptosis and interaction with CED-4. EMBO J. 1998 Feb 16;17(4):1029-39.

[PubMed ID: 8918887] ... Wang K, Yin XM, Chao DT, Milliman CL, Korsmeyer SJ, BID: a novel BH3 domain-only death agonist. Genes Dev. 1996 Nov 15;10(22):2859-69.

[PubMed ID: 7774948] ... Amagai M, Wang Y, Minoshima S, Kawamura K, Green KJ, Nishikawa T, Shimizu N, Assignment of the human genes for desmocollin 3 (DSC3) and desmocollin 4 (DSC4) to chromosome 18q12. Genomics. 1995 Jan 1;25(1):330-2.

[PubMed ID: 7929347] ... Kawamura K, Watanabe K, Suzuki T, Yamakawa T, Kamiyama T, Nakagawa H, Tsurufuji S, cDNA cloning and expression of a novel human desmocollin. J Biol Chem. 1994 Oct 21;269(42):26295-302.