CaMPDB :: Substrate

SB0105 : Ezrin

* Basic Information

Organism	Rattus norvegicus (Norway rat)
Protein Names	ezrin [Rattus norvegicus]; ezrin; p81; villin-2; cytovillin; villin 2; Ezrin; Cytovillin; Villin-2
Gene Names	Ezr; Vil2; ezrin
Gene Locus	1q11; chromosome 1
GO Function	Not available

Entrez Protein	Entrez Nucleotide	Entrez Gene	UniProt	OMIM	HGNC	HPRD	KEGG
NP_062230	NM_019357	54319	P31977	N/A	N/A	N/A	rno:54319

* Information From OMIM

Not Available.

* Structure Information

1. Primary Information

Length: 586 aa

Average Mass: 69.390 kDa

Monoisotopic Mass: 69.348 kDa

2. Domain Information

Annotated Domains: interpro / pfam / smart / prosite

Computationally Assigned Domains (Pfam+HMMER):

domain name	begin	end	score	e-value
FERM N-terminal domain 1.	10	69	2.0	0.0
FERM N-terminal domain 2.	198	218	35.0	0.0
Ezrin/radixin/moesin family 1.	301	333	58.0	12.9
FERM central domain 1.	366	436	58.0	21.3

3. Sequence Information

Fasta Sequence: SB0105.fasta

Amino Acid Sequence and Secondary Structures (PsiPred):

4. 3D Information

Not Available.

* Cleavage Information

1 [sites] cleaved by Calpain 1

Source Reference: [PubMed ID: 18625712] Wang F, Xia P, Wu F, Wang D, Wang W, Ward T, Liu Y, Aikhionbare F, Guo Z, Powell M, Liu B, Bi F, Shaw A, Zhu Z, Elmoselhi A, Fan D, Cover TL, Ding X, Yao X, Helicobacter pylori VacA disrupts apical membrane-cytoskeletal interactions in gastric parietal cells. J Biol Chem. 2008 Sep 26;283(39):26714-25. doi: 10.1074/jbc.M800527200. Epub 2008

Cleavage sites (±10aa)

[Site 1] KTKEELHLVM⁴⁶⁷-TAPPPPPPPV

Met⁴⁶⁷ Thr

P10	P9	P8	P7	P6	P5	P4	P3	P2	P1

Lys⁴⁵⁸	Thr⁴⁵⁹	Lys⁴⁶⁰	Glu⁴⁶¹	Glu⁴⁶²	Leu⁴⁶³	His⁴⁶⁴	Leu⁴⁶⁵	Val⁴⁶⁶	Met⁴⁶⁷

P1'	P2'	P3'	P4'	P5'	P6'	P7'	P8'	P9'	P10'
Thr⁴⁶⁸	Ala⁴⁶⁹	Pro⁴⁷⁰	Pro⁴⁷¹	Pro⁴⁷²	Pro⁴⁷³	Pro⁴⁷⁴	Pro⁴⁷⁵	Pro⁴⁷⁶	Val⁴⁷⁷

Sequence conservation (by blast) Sequence conservation (by blast)

Reference peptide (cleaved bond±30 residues)
KEDEVEEWQHRAKEAQDDLVKTKEELHLVMTAPPPPPPPVYEPVNYHVQEGLQDEGAEPM

Summary

#	organism	max score	hits	top seq
1	Mus musculus	127.00	16	unnamed protein product
2	Rattus norvegicus	127.00	5	villin 2
3	Homo sapiens	120.00	6	unnamed protein product
4	N/A	120.00	2	cytovillin 2
5	Canis familiaris	95.90	9	PREDICTED: similar to villin 2 isoform 1
6	Oryctolagus cuniculus	92.00	1	villin 2 (ezrin)
7	Bos taurus	84.00	3	ezrin
8	Gallus gallus	82.00	2	ezrin
9	Tetraodon nigroviridis	45.40	4	unnamed protein product
10	Xenopus laevis	40.80	1	U29763_1 moesin
11	mice, keratinocytes, Balb/MK, Peptide, 583 aa	38.10	1	RADI_MOUSE Radixin (ESP10) gi
12	Sus scrofa	37.70	2	radixin
13	Canis familiaris	35.40	3	PREDICTED: similar to Moesin (Membrane-organizing

Top-ranked sequences

organism	matching
Mus musculus	Query 438 KEDEVEEWQHRAKEAQDDLVKTKEELHLVM#TAPPPPPPPVYEPVNYHVQEGLQDEGAEPM 497 \|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|#\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\| Query 438 KEDEVEEWQHRAKEAQDDLVKTKEELHLVM#TAPPPPPPPVYEPVNYHVQEGLQDEGAEPM 497
Rattus norvegicus	Query 438 KEDEVEEWQHRAKEAQDDLVKTKEELHLVM#TAPPPPPPPVYEPVNYHVQEGLQDEGAEPM 497 \|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|#\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\| Query 438 KEDEVEEWQHRAKEAQDDLVKTKEELHLVM#TAPPPPPPPVYEPVNYHVQEGLQDEGAEPM 497
Homo sapiens	Query 438 KEDEVEEWQHRAKEAQDDLVKTKEELHLVM#TAPPPPPPPVYEPVNYHVQEGLQDEGAEP 496 \|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|#\|\|\|\|\|\|\|\|\|\|\|\|\|\|+\|\|\|\|\| \|\|\|\|\|\|\|\| Sbjct 438 KEDEVEEWQHRAKEAQDDLVKTKEELHLVM#TAPPPPPPPVYEPVSYHVQESLQDEGAEP 496
N/A	Query 438 KEDEVEEWQHRAKEAQDDLVKTKEELHLVM#TAPPPPPPPVYEPVNYHVQEGLQDEGAEP 496 \|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|#\|\|\|\|\|\|\|\|\|\|\|\|\|\|+\|\|\|\|\| \|\|\|\|\|\|\|\| Sbjct 427 KEDEVEEWQHRAKEAQDDLVKTKEELHLVM#TAPPPPPPPVYEPVSYHVQESLQDEGAEP 485
Canis familiaris	Query 438 KEDEVEEWQHRAKEAQDDLVKTKEELHLVM#TAPPPPPPPVYEPVNYHVQEGLQDEGAE 495 \|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|#\|\|\|\|\|\|\|\|\|\|\|\|\|\|+\|\|\|\|+ \|\|+\|\| \| Sbjct 438 KEDEVEEWQHRAKEAQDDLVKTKEELHLVM#TAPPPPPPPVYEPVSYHVQDNLQEEGTE 495
Oryctolagus cuniculus	Query 438 KEDEVEEWQHRAKEAQDDLVKTKEELHLVM#TAPPPPPPPVYEPVNYHVQEGLQDEGAEPM 497 \|\| \|\|\|\|\|\|\|\|\|+\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|#\|\|\|\|\|\|\|\|\|+\|\|\|\|+\|\|\|\|\| \| +\|\|\|\| + Sbjct 438 KESEVEEWQHRAREAQDDLVKTKEELHLVM#TAPPPPPPPMYEPVSYHVQEHLHEEGAESL 497
Bos taurus	Query 438 KEDEVEEWQHRAKEAQDDLVKTKEELHLVM#TAPPPPPPPVYEPVNYHVQEGLQDEGAE 495 \|\|+\|\|\|\|\|\| \|\|\|\|\|\|\|\|\|\|\|\|+\|\|\|\|\|\|\|#\|\| \|\|\|\|\|\|\|\|\|\|\|\|\|\| \|\| \|+\|\| \| Sbjct 438 KENEVEEWQLRAKEAQDDLVKTREELHLVM#TA--PPPPPVYEPVNYHVHEGPQEEGTE 493
Gallus gallus	Query 438 KEDEVEEWQHRAKEAQDDLVKTKEELHLVM#TAPPPPPPPVYEPVNYHVQEGLQDEGAE 495 \|\| \|\|\|\|\|\| \|\|+\|\|\|+\|\|\|\|\|\|\|\|\|\|\|\|\|#\|\| \|\|\|\|\|\|+\|\|\|\|\|\|\|\| + \| \|\|\|+\| Sbjct 438 KESEVEEWQIRAREAQEDLVKTKEELHLVM#TA-PPPPPPIYEPVNYHVHDNLHDEGSE 494
Tetraodon nigroviridis	Query 442 VEEWQHRAKEAQDDLVKTKEELHLVM#TAPPPPPPPVYEPVNYHVQEGLQDEG 493 \| +\|\|\|+\| \|\|\|\|\| \|\|+\|\|\| \|#\|\|\|\| \| + \| \| \|\| Sbjct 438 VTDWQHKALVAQDDLEKTREELKSAM#TAPPAPEHDEQDETNAEASAELLSEG 489
Xenopus laevis	Query 438 KEDEVEEWQHRAKEAQDDLVKTKEELHLVM#TAPPPPPP 475 \|\|+\| \|\|\| +\| \| \|\| \|\|+\|\|\| \|\|\|#\| \| \| Sbjct 438 KEEEANEWQMKAHNVQADLEKTQEELKLVM#TTPHVSEP 475
mice, keratinocytes, Balb/MK, Peptide, 583 aa	Query 444 EWQHRAKEAQDDLVKTKEELHLVM#TAPP 471 \|\|\|\|+\| \|\|+\|\| \|\|\|\|\|\| \|\|#+\|\|\| Sbjct 444 EWQHKAFAAQEDLEKTKEELKTVM#SAPP 471
Sus scrofa	Query 444 EWQHRAKEAQDDLVKTKEELHLVM#TAPP 471 \|\|\|\|+\| \|\|+\|\| \|\|\|\|\|\| \|\|#+\|\|\| Sbjct 444 EWQHKAFAAQEDLEKTKEELKTVM#SAPP 471
Canis familiaris	Query 438 KEDEVEEWQHRAKEAQDDLVKTKEELHLVM#TAPPPPPPP 476 \|\|+\| \|\|\| +\|+ \|+\|\| \|\|+ \|\| \|#+ \| \| Sbjct 446 KENEAVEWQQKAQMVQEDLEKTRAELKTAM#STPHVAEPA 484

* References

[PubMed ID: 24091598] Nakano T, Sekine S, Ito K, Horie T, Ezrin regulates the expression of Mrp2/Abcc2 and Mdr1/Abcb1 along the rat small intestinal tract. Am J Physiol Gastrointest Liver Physiol. 2013 Dec;305(11):G807-17. doi:

» More (9) « Hide Below

[PubMed ID: 24184478] ... Baeyens N, Latrache I, Yerna X, Noppe G, Horman S, Morel N, Redundant control of migration and adhesion by ERM proteins in vascular smooth muscle cells. Biochem Biophys Res Commun. 2013 Nov 22;441(3):579-85. doi:

[PubMed ID: 21777186] ... Mahon MJ, The parathyroid hormone receptorsome and the potential for therapeutic intervention. Curr Drug Targets. 2012 Jan;13(1):116-28.

[PubMed ID: 21753079] ... Lavialle M, Aumann G, Anlauf E, Prols F, Arpin M, Derouiche A, Structural plasticity of perisynaptic astrocyte processes involves ezrin and metabotropic glutamate receptors. Proc Natl Acad Sci U S A. 2011 Aug 2;108(31):12915-9. doi:

[PubMed ID: 22132106] ... Sperka T, Geissler KJ, Merkel U, Scholl I, Rubio I, Herrlich P, Morrison HL, Activation of Ras requires the ERM-dependent link of actin to the plasma membrane. PLoS One. 2011;6(11):e27511. doi: 10.1371/journal.pone.0027511. Epub 2011 Nov 21.

[PubMed ID: 12900915] ... Mintz CD, Dickson TC, Gripp ML, Salton SR, Benson DL, ERMs colocalize transiently with L1 during neocortical axon outgrowth. J Comp Neurol. 2003 Sep 29;464(4):438-48.

[PubMed ID: 11726633] ... Bonilha VL, Rodriguez-Boulan E, Polarity and developmental regulation of two PDZ proteins in the retinal pigment epithelium. Invest Ophthalmol Vis Sci. 2001 Dec;42(13):3274-82.

[PubMed ID: 11461930] ... Orlando RA, Takeda T, Zak B, Schmieder S, Benoit VM, McQuistan T, Furthmayr H, Farquhar MG, The glomerular epithelial cell anti-adhesin podocalyxin associates with the actin cytoskeleton through interactions with ezrin. J Am Soc Nephrol. 2001 Aug;12(8):1589-98.

[PubMed ID: 11457882] ... Takeda T, McQuistan T, Orlando RA, Farquhar MG, Loss of glomerular foot processes is associated with uncoupling of podocalyxin from the actin cytoskeleton. J Clin Invest. 2001 Jul;108(2):289-301.

[PubMed ID: 7640303] ... Barila D, Murgia C, Nobili F, Perozzi G, Transcriptional regulation of the ezrin gene during rat intestinal development and epithelial differentiation. Biochim Biophys Acta. 1995 Aug 22;1263(2):133-40.