CaMPDB :: Substrate

SB0108 : Aggrecan

* Basic Information

Organism	Rattus norvegicus (Norway rat)
Protein Names	aggrecan core protein precursor [Rattus norvegicus]; aggrecan core protein precursor; aggrecan core protein; CSPCP; cartilage-specific proteoglycan core protein; aggrecan 1; aggrecan, structural proteoglycan of cartilage
Gene Names	Acan; aggrecan
Gene Locus	1q31; chromosome 1
GO Function	Not available

Entrez Protein	Entrez Nucleotide	Entrez Gene	UniProt	OMIM	HGNC	HPRD	KEGG
NP_071526	NM_022190	58968	N/A	N/A	N/A	N/A	N/A

* Information From OMIM

Not Available.

* Structure Information

1. Primary Information

Length: 2162 aa

Average Mass: 225.237 kDa

Monoisotopic Mass: 225.102 kDa

2. Domain Information

Annotated Domains: Not Available.

Computationally Assigned Domains (Pfam+HMMER):

domain name	begin	end	score	e-value
Chordopoxvirus A33R protein 1.	150	183	103.0	0.0
Chordopoxvirus A33R protein 2.	257	283	113.0	0.0
Domain of unknown function 1.	350	399	36.0	0.0
Chordopoxvirus A33R protein 3.	499	518	119.0	0.0
Chordopoxvirus A33R protein 4.	593	625	115.0	0.1
EGF-like domain 1.	678	685	8.0	0.0
--- cleavage 715 ---
EGF-like domain 2.	1914	1943	1.0	1.1
Chordopoxvirus A33R protein 5.	1958	1988	107.0	0.0
Sushi repeat (SCR repeat) 1.	2079	2135	1.0	0.7

3. Sequence Information

Fasta Sequence: SB0108.fasta

Amino Acid Sequence and Secondary Structures (PsiPred):

4. 3D Information

Not Available.

* Cleavage Information

1 [sites] cleaved by Calpain 2

Source Reference: [PubMed ID: 15175011] Oshita H, Sandy JD, Suzuki K, Akaike A, Bai Y, Sasaki T, Shimizu K, Mature bovine articular cartilage contains abundant aggrecan that is C-terminally truncated at Ala719-Ala720, a site which is readily cleaved by m-calpain. Biochem J. 2004 Aug 15;382(Pt 1):253-9.

Cleavage sites (±10aa)

[Site 1] IVTRVEPGVD⁷¹⁵-AVPLEPETTE

Asp⁷¹⁵ Ala

P10	P9	P8	P7	P6	P5	P4	P3	P2	P1

Ile⁷⁰⁶	Val⁷⁰⁷	Thr⁷⁰⁸	Arg⁷⁰⁹	Val⁷¹⁰	Glu⁷¹¹	Pro⁷¹²	Gly⁷¹³	Val⁷¹⁴	Asp⁷¹⁵

P1'	P2'	P3'	P4'	P5'	P6'	P7'	P8'	P9'	P10'
Ala⁷¹⁶	Val⁷¹⁷	Pro⁷¹⁸	Leu⁷¹⁹	Glu⁷²⁰	Pro⁷²¹	Glu⁷²²	Thr⁷²³	Thr⁷²⁴	Glu⁷²⁵

Sequence conservation (by blast) Sequence conservation (by blast)

Reference peptide (cleaved bond±30 residues)
VSVVPSPGGTPTSPSDIEDWIVTRVEPGVDAVPLEPETTEVPYFTTEPEKQTEWEPAYTP

#	organism	max score	hits	top seq
1	N/A	120.00	4	PGCA_RAT Aggrecan core protein precursor (Cartila
2	Rattus norvegicus	120.00	1	aggrecan 1
3	Bos taurus	68.90	1	aggrecan 1
4	Sus scrofa	65.50	1	AF314813_1 aggrecan G2 domain
5	Canis lupus familiaris	64.70	1	aggrecan 1

organism	matching
N/A	Query 686 VSVVPSPGGTPTSPSDIEDWIVTRVEPGVD#AVPLEPETTEVPYFTTEPEKQTEWEPAYTP 745 \|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|#\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\| Query 686 VSVVPSPGGTPTSPSDIEDWIVTRVEPGVD#AVPLEPETTEVPYFTTEPEKQTEWEPAYTP 745
Rattus norvegicus	Query 686 VSVVPSPGGTPTSPSDIEDWIVTRVEPGVD#AVPLEPETTEVPYFTTEPEKQTEWEPAYTP 745 \|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|#\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\| Query 686 VSVVPSPGGTPTSPSDIEDWIVTRVEPGVD#AVPLEPETTEVPYFTTEPEKQTEWEPAYTP 745
Bos taurus	Query 686 VSVVPSP----GGTPTSPSDIEDWIVTRVEPGVD#AVPLEPETTEVPYFTTEPEKQTEWEP 741 \|\| \|\|\| \| \|\|+ \|+\|+\|+\|\|+\| \|\|\| #\|\|\|+ \|\|\| +\| \|\| \|\|\| +\|\|\|\| Sbjct 686 VSAAPSPEEEEGSAPTAGPDVEEWMVTQVGPGVA#AVPIGEETTAIPGFTVEPENKTEWEL 745 Query 742 AYTP 745 \|\|\|\| Query 742 AYTP 745
Sus scrofa	Query 687 SVVPSPG----GTPTSPSDIEDWIVTRVEPGVD#AVPLEPETTEVPYFTTEPEKQTEWEPA 742 +\| \|\|\|\| \|\|\|\|\| \|+\|+ \| \|+\| \|\|\| #\|\|\|+ \|\|\|\|\| \|\|\|\|\|\| +\|\|\|\| Sbjct 349 AVAPSPGEEEGGTPTSLPDLEERIATQVGPGVA#AVPVGEETTEVAAFTTEPENRTEWEFV 408 Query 743 YTP 745 \|\|\| Query 743 YTP 745
Canis lupus familiaris	Query 686 VSVVPSPG----GTPTSPSDIEDWIVTRVEPGVD#AVPLEPETTEVPYFTTEPEKQTEWEP 741 \|\| \|\|\|\|\| \|\|\|\| \|\| +\|\|\|\| \|+\| \| \| #+\|\|+ \|\|\| + \|\| \|\|\| \|\|\|\|\|\| Sbjct 695 VSGVPSPGEEEGGTPT-PSVVEDWIPTQVGPVVP#SVPMGEETTAILDFTIEPENQTEWEP 753 Query 742 AYTP 745 \|\|+\| Sbjct 754 AYSP 757

* References

[PubMed ID: 22961837] Zhang Y, Ross AC, Retinoic acid and the transcription factor MafB act together and differentially to regulate aggrecan and matrix metalloproteinase gene expression in neonatal chondrocytes. J Cell Biochem. 2013 Feb;114(2):471-9. doi: 10.1002/jcb.24387.

» More (9) « Hide Below

[PubMed ID: 22357747] ... Zhang Y, Wray AE, Ross AC, Perinatal exposure to vitamin A differentially regulates chondrocyte growth and the expression of aggrecan and matrix metalloprotein genes in the femur of neonatal rats. J Nutr. 2012 Apr;142(4):649-54. doi: 10.3945/jn.111.152660. Epub 2012 Feb 22.

[PubMed ID: 22306080] ... Chen LF, FitzGibbon T, He JR, Yin ZQ, Localization and developmental expression patterns of CSPG-cs56 (aggrecan) in normal and dystrophic retinas in two rat strains. Exp Neurol. 2012 Apr;234(2):488-98. doi: 10.1016/j.expneurol.2012.01.023. Epub

[PubMed ID: 21055467] ... Zhang YH, Zhao CQ, Jiang LS, Dai LY, Substrate stiffness regulates apoptosis and the mRNA expression of extracellular matrix regulatory genes in the rat annular cells. Matrix Biol. 2011 Mar;30(2):135-44. doi: 10.1016/j.matbio.2010.10.008. Epub 2010

[PubMed ID: 20592578] ... Brisby H, Wei AQ, Molloy T, Chung SA, Murrell GA, Diwan AD, The effect of running exercise on intervertebral disc extracellular matrix production in a rat model. Spine (Phila Pa 1976). 2010 Jul 1;35(15):1429-36. doi:

[PubMed ID: 8641562] ... Perris R, Perissinotto D, Pettway Z, Bronner-Fraser M, Morgelin M, Kimata K, Inhibitory effects of PG-H/aggrecan and PG-M/versican on avian neural crest cell migration. FASEB J. 1996 Feb;10(2):293-301.

[PubMed ID: 8349621] ... Fulop C, Walcz E, Valyon M, Glant TT, Expression of alternatively spliced epidermal growth factor-like domains in aggrecans of different species. Evidence for a novel module. J Biol Chem. 1993 Aug 15;268(23):17377-83.

[PubMed ID: 3693371] ... Neame PJ, Christner JE, Baker JR, Cartilage proteoglycan aggregates. The link protein and proteoglycan amino-terminal globular domains have similar structures. J Biol Chem. 1987 Dec 25;262(36):17768-78.

[PubMed ID: 3693370] ... Doege K, Sasaki M, Horigan E, Hassell JR, Yamada Y, Complete primary structure of the rat cartilage proteoglycan core protein deduced from cDNA clones. J Biol Chem. 1987 Dec 25;262(36):17757-67.

[PubMed ID: 2424893] ... Doege K, Fernandez P, Hassell JR, Sasaki M, Yamada Y, Partial cDNA sequence encoding a globular domain at the C terminus of the rat cartilage proteoglycan. J Biol Chem. 1986 Jun 25;261(18):8108-11.