CaMPDB :: Substrate

SB0117 : Type 1 inositol 1,4,5-triphosphate receptor, InsP3R1

* Basic Information

Organism	Rattus norvegicus (Norway rat)
Protein Names	inositol 1,4,5-trisphosphate receptor type 1 [Rattus norvegicus]; inositol 1,4,5-trisphosphate receptor type 1; IP-3-R; type 1 InsP3 receptor; IP3 receptor; type 1 inositol 1,4,5-trisphosphate receptor; IP3R 1; inositol 1,4,5-triphosphate receptor, type 1; inositol 1,4,5-triphosphate receptor 1
Gene Names	Itpr1; inositol 1,4,5-trisphosphate receptor, type 1
Gene Locus	4q41; chromosome 4
GO Function	Not available

Entrez Protein	Entrez Nucleotide	Entrez Gene	UniProt	OMIM	HGNC	HPRD	KEGG
NP_001007236	NM_001007235	25262	N/A	N/A	N/A	N/A	N/A

* Information From OMIM

Not Available.

* Structure Information

1. Primary Information

Length: 2749 aa

Average Mass: 313.133 kDa

Monoisotopic Mass: 312.937 kDa

2. Domain Information

Annotated Domains: Not Available.

Computationally Assigned Domains (Pfam+HMMER):

domain name	begin	end	score	e-value
MIR domain 1.	109	144	60.0	0.0
Inositol 1,4,5-trisphosphate/ryanodine receptor 1.	236	256	100.0	0.0
RyR and IP3R Homology associated 1.	503	525	22.0	0.7
RyR and IP3R Homology associated 2.	558	581	12.0	0.1
RyR and IP3R Homology associated 3.	1281	1308	50.0	0.4
RIH domain 1.	1453	1475	156.0	0.1
RyR and IP3R Homology associated 4.	1532	1683	6.0	0.4
--- cleavage 1917 ---
RIH domain 2.	1978	1992	31.0	0.1
Ion transport protein 1.	2269	2292	200.0	1.5
Ion transport protein 2.	2354	2599	34.0	5.3
RyR and IP3R Homology associated 5.	2688	2725	23.0	0.4

3. Sequence Information

Fasta Sequence: SB0117.fasta

Amino Acid Sequence and Secondary Structures (PsiPred):

4. 3D Information

Not Available.

* Cleavage Information

1 [sites] cleaved by Calpain 1

Source Reference: [PubMed ID: 21859719] Kopil CM, Vais H, Cheung KH, Siebert AP, Mak DO, Foskett JK, Neumar RW, Calpain-cleaved type 1 inositol 1,4,5-trisphosphate receptor (InsP(3)R1) has InsP(3)-independent gating and disrupts intracellular Ca(2+) homeostasis. J Biol Chem. 2011 Oct 14;286(41):35998-6010. doi: 10.1074/jbc.M111.254177. Epub

Cleavage sites (±10aa)

[Site 1] TEEVRDQLLE¹⁹¹⁷-ASAATRKAFT

Glu¹⁹¹⁷ Ala

P10	P9	P8	P7	P6	P5	P4	P3	P2	P1

Thr¹⁹⁰⁸	Glu¹⁹⁰⁹	Glu¹⁹¹⁰	Val¹⁹¹¹	Arg¹⁹¹²	Asp¹⁹¹³	Gln¹⁹¹⁴	Leu¹⁹¹⁵	Leu¹⁹¹⁶	Glu¹⁹¹⁷

P1'	P2'	P3'	P4'	P5'	P6'	P7'	P8'	P9'	P10'
Ala¹⁹¹⁸	Ser¹⁹¹⁹	Ala¹⁹²⁰	Ala¹⁹²¹	Thr¹⁹²²	Arg¹⁹²³	Lys¹⁹²⁴	Ala¹⁹²⁵	Phe¹⁹²⁶	Thr¹⁹²⁷

Sequence conservation (by blast) Sequence conservation (by blast)

Reference peptide (cleaved bond±30 residues)
DEVDRDAPSRKKAKEPTTQITEEVRDQLLEASAATRKAFTTFRREADPDDHYQSGEGTQA

Summary

#	organism	max score	hits	top seq
1	N/A	122.00	8	ITPR1_MOUSE Inositol 1,4,5-trisphosphate receptor
2	Rattus norvegicus	122.00	2	inositol 1,4,5-triphosphate receptor 1
3	Homo sapiens	121.00	2	inositol 1,4,5-trisphosphate receptor type 1
4	Bos taurus	119.00	2	inositol 1,4,5-triphosphate receptor, type 1
5	Canis familiaris	115.00	9	PREDICTED: similar to Inositol 1,4,5-trisphosphate
6	Xenopus laevis	77.80	1	inositol 1,4,5-triphosphate receptor
7	Tetraodon nigroviridis	76.60	3	unnamed protein product
8	Rattus norvegicus	41.20	1	AF329470_1 IP3 receptor isoform 2
9	Mus musculus	40.00	2	Itpr2 protein

Top-ranked sequences

organism	matching
N/A	Query 1888 DEVDRDAPSRKKAKEPTTQITEEVRDQLLE#ASAATRKAFTTFRREADPDDHYQSGEGTQA 1947 \|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|#\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\| Query 1888 DEVDRDAPSRKKAKEPTTQITEEVRDQLLE#ASAATRKAFTTFRREADPDDHYQSGEGTQA 1947
Rattus norvegicus	Query 1888 DEVDRDAPSRKKAKEPTTQITEEVRDQLLE#ASAATRKAFTTFRREADPDDHYQSGEGTQA 1947 \|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|#\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\| Query 1888 DEVDRDAPSRKKAKEPTTQITEEVRDQLLE#ASAATRKAFTTFRREADPDDHYQSGEGTQA 1947
Homo sapiens	Query 1888 DEVDRDAPSRKKAKEPTTQITEEVRDQLLE#ASAATRKAFTTFRREADPDDHYQSGEGTQA 1947 \|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|#\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\| \|\|\|\|\|\| Sbjct 1849 DEVDRDAPSRKKAKEPTTQITEEVRDQLLE#ASAATRKAFTTFRREADPDDHYQPGEGTQA 1908
Bos taurus	Query 1888 DEVDRDAPSRKKAKEPTTQITEEVRDQLLE#ASAATRKAFTTFRREADPDDHYQSGEGTQA 1947 \|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\| \|\|\|\|\|\|\|\|\|\|\|\|\|#\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\| \|\| Sbjct 1848 DEVDRDAPSRKKAKEPATQITEEVRDQLLE#ASAATRKAFTTFRREADPDDHYQSGEGAQA 1907
Canis familiaris	Query 1888 DEVDRDAPSRKKAKEPTTQITEEVRDQLLE#ASAATRKAFTTFRREADPDDHYQSGEGTQA 1947 \|\| \|\|\|\|\|\|\|\|\|\|\|\|\|+\|\|\|\|\|\| \|\|\|\|\|\|#\|\|\|\|\|\|\|\|\|+\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\| \|\| Sbjct 1895 DETDRDAPSRKKAKEPSTQITEEARDQLLE#ASAATRKAFSTFRREADPDDHYQSGEGAQA 1954
Xenopus laevis	Query 1888 DEVDRDAPSRKKAKEPTTQITEEVRDQLLE#ASAATRKAFTTFRREADPDDHYQSGEGTQA 1947 ++ +\|+ \| ++ +\|\|+ \|\|\|\|\| ++\|\|+\|#\|\| \|\|+\|\|+ +\|\|\|\|\|\|\|\|\|\|+ \|\|\| \| Sbjct 1834 EQSERETPHHQRVREPSGQITEEAKEQLIE#ASVATKKAYYSFRREADPDDHFSLGEGVMA 1893
Tetraodon nigroviridis	Query 1888 DEVDRDAPSRKKAKEPTTQITEEVRDQLLE#ASAATRKAFTTFRREADPDDHYQSGEG 1944 \| \|+\| \| \|\|\| +\| + +\|\|+\|\|+\|\|\|\|#\|\|+\|\|+\|\|\| ++\|\|\|\|\|\|+\|\|+ +\| Sbjct 1613 DSQDKDGPVRKKVRESSVVMTEDVREQLLE#ASSATKKAFNSYRREADPEDHFNVADG 1669
Rattus norvegicus	Query 1897 RKKAKEPTTQITEEVRDQLLE#ASAATRKAFTTFRREADPD 1936 \| + ++ + + \| ++ \|\| \|#\|\|+\|\| \|\|+ +\|\|\| \|\|\| Sbjct 1849 RMRVRDSSLHLKEGMKGQLTE#ASSATSKAYCVYRREMDPD 1888
Mus musculus	Query 1897 RKKAKEPTTQITEEVRDQLLE#ASAATRKAFTTFRREADPD 1936 \| + ++ + + \| ++ \|\| \|#\|\|+\|\| \|\|+ +\|\|\| \|\|+ Sbjct 560 RMRVRDSSLHLREGMKGQLTE#ASSATSKAYCVYRREMDPE 599

* References

[PubMed ID: 22286060] Seo MD, Velamakanni S, Ishiyama N, Stathopulos PB, Rossi AM, Khan SA, Dale P, Li C, Ames JB, Ikura M, Taylor CW, Structural and functional conservation of key domains in InsP3 and ryanodine receptors. Nature. 2012 Jan 29;483(7387):108-12. doi: 10.1038/nature10751.

» More (9) « Hide Below

[PubMed ID: 22207335] ... Subedi KP, Singh TD, Kim JC, Woo SH, Cloning and expression of a new inositol 1,4,5-trisphosphate receptor type 1 splice variant in adult rat atrial myocytes. Cell Mol Biol Lett. 2012 Mar;17(1):124-35. doi: 10.2478/s11658-011-0043-7. Epub

[PubMed ID: 21859719] ... Kopil CM, Vais H, Cheung KH, Siebert AP, Mak DO, Foskett JK, Neumar RW, Calpain-cleaved type 1 inositol 1,4,5-trisphosphate receptor (InsP(3)R1) has InsP(3)-independent gating and disrupts intracellular Ca(2+) homeostasis. J Biol Chem. 2011 Oct 14;286(41):35998-6010. doi: 10.1074/jbc.M111.254177. Epub

[PubMed ID: 21827954] ... Ludtke SJ, Tran TP, Ngo QT, Moiseenkova-Bell VY, Chiu W, Serysheva II, Flexible architecture of IP3R1 by Cryo-EM. Structure. 2011 Aug 10;19(8):1192-9. doi: 10.1016/j.str.2011.05.003.

[PubMed ID: 21777465] ... Li M, Shang YX, Wei B, Yang YG, The effect of substance P on asthmatic rat airway smooth muscle cell proliferation, migration, and cytoplasmic calcium concentration in vitro. J Inflamm (Lond). 2011 Jul 21;8(1):18. doi: 10.1186/1476-9255-8-18.

[PubMed ID: 8567977] ... Olson TM, Keating MT, Mapping a cardiomyopathy locus to chromosome 3p22-p25. J Clin Invest. 1996 Jan 15;97(2):528-32.

[PubMed ID: 7500836] ... Zhang SX, Zhang JP, Fletcher DL, Zoeller RT, Sun GY, In situ hybridization of mRNA expression for IP3 receptor and IP3-3-kinase in rat brain after transient focal cerebral ischemia. Brain Res Mol Brain Res. 1995 Sep;32(2):252-60.

[PubMed ID: 1338970] ... Suzuki T, Abe-Dohmae S, Tanaka R, P400 protein is one of the major substrates for Ca2+/calmodulin-dependent protein kinase II in the postsynaptic density-enriched fraction isolated from rat cerebral cortex, hippocampus and cerebellum. Neurochem Int. 1992 Jan;20(1):61-7.

[PubMed ID: 1849282] ... Danoff SK, Ferris CD, Donath C, Fischer GA, Munemitsu S, Ullrich A, Snyder SH, Ross CA, Inositol 1,4,5-trisphosphate receptors: distinct neuronal and nonneuronal forms derived by alternative splicing differ in phosphorylation. Proc Natl Acad Sci U S A. 1991 Apr 1;88(7):2951-5.

[PubMed ID: 2165071] ... Mignery GA, Newton CL, Archer BT 3rd, Sudhof TC, Structure and expression of the rat inositol 1,4,5-trisphosphate receptor. J Biol Chem. 1990 Jul 25;265(21):12679-85.