CaMPDB :: Substrate

SB0122 : Focal adhesion kinase, FAK

* Basic Information

Organism	Mus musculus (house mouse)
Protein Names	focal adhesion kinase 1 isoform 1 [Mus musculus]; focal adhesion kinase 1 isoform 1; focal adhesion kinase 1; FADK 1; pp125FAK; protein-tyrosine kinase 2; focal adhesion kinase-related nonkinase; focal ashension kinase 1
Gene Names	Ptk2; PTK2 protein tyrosine kinase 2
Gene Locus	15 33.94 cM; chromosome 15
GO Function	Not available

Entrez Protein	Entrez Nucleotide	Entrez Gene	UniProt	OMIM	HGNC	HPRD	KEGG
NP_032008	NM_007982	14083	N/A	N/A	N/A	N/A	N/A

* Information From OMIM

Not Available.

* Structure Information

1. Primary Information

Length: 1052 aa

Average Mass: 119.242 kDa

Monoisotopic Mass: 119.167 kDa

2. Domain Information

Annotated Domains: Not Available.

Computationally Assigned Domains (Pfam+HMMER):

domain name	begin	end	score	e-value
FERM central domain 1.	138	251	5.0	0.2
FERM central domain 2.	451	478	80.0	0.0
Kinase-like 1.	501	615	125.0	0.0
--- cleavage 745 ---
FERM central domain 3.	986	1018	58.0	0.0

3. Sequence Information

Fasta Sequence: SB0122.fasta

Amino Acid Sequence and Secondary Structures (PsiPred):

4. 3D Information

Not Available.

* Cleavage Information

1 [sites] cleaved by Calpain 2

Source Reference: [PubMed ID: 20150423] Chan KT, Bennin DA, Huttenlocher A, Regulation of adhesion dynamics by calpain-mediated proteolysis of focal adhesion kinase (FAK). J Biol Chem. 2010 Apr 9;285(15):11418-26. doi: 10.1074/jbc.M109.090746. Epub 2010

Cleavage sites (±10aa)

[Site 1] MVQTNHYQVS⁷⁴⁵-GYPGSHGIPA

Ser⁷⁴⁵ Gly

P10	P9	P8	P7	P6	P5	P4	P3	P2	P1

Met⁷³⁶	Val⁷³⁷	Gln⁷³⁸	Thr⁷³⁹	Asn⁷⁴⁰	His⁷⁴¹	Tyr⁷⁴²	Gln⁷⁴³	Val⁷⁴⁴	Ser⁷⁴⁵

P1'	P2'	P3'	P4'	P5'	P6'	P7'	P8'	P9'	P10'
Gly⁷⁴⁶	Tyr⁷⁴⁷	Pro⁷⁴⁸	Gly⁷⁴⁹	Ser⁷⁵⁰	His⁷⁵¹	Gly⁷⁵²	Ile⁷⁵³	Pro⁷⁵⁴	Ala⁷⁵⁵

Sequence conservation (by blast) Sequence conservation (by blast)

Reference peptide (cleaved bond±30 residues)
SRPGYPSPRSSEGFYPSPQHMVQTNHYQVSGYPGSHGIPAMAGSIYQGQASLLDQTELWN

Summary

#	organism	max score	hits	top seq
1	N/A	129.00	4	FAK1_MOUSE Focal adhesion kinase 1 (FADK 1) (pp12
2	Mus musculus	129.00	3	unnamed protein product
3	Mus musculus	129.00	1	PTK2 protein tyrosine kinase 2
4	Rattus norvegicus	125.00	1	PTK2 protein tyrosine kinase 2
5	Canis familiaris	120.00	5	PREDICTED: similar to Focal adhesion kinase 1 (FA
6	Homo sapiens	119.00	6	PTK2 protein tyrosine kinase 2 isoform a
7	Gallus gallus	116.00	1	PTK2 protein tyrosine kinase 2
8	Xenopus tropicalis	99.80	1	PTK2 protein tyrosine kinase 2
9	Xenopus laevis	98.20	1	focal adhesion kinase pp125FAK
10	Danio rerio	76.30	2	protein tyrosine kinase 2.1
11	Tetraodon nigroviridis	65.10	1	unnamed protein product
12	Methanococcus maripaludis S2	33.10	1	hypothetical protein MMP0906
13	Saccharomyces cerevisiae	30.80	1	GDP/GTP exchange protein (GEP) for Rho1p and Rho2

Top-ranked sequences

organism	matching
N/A	Query 716 SRPGYPSPRSSEGFYPSPQHMVQTNHYQVS#GYPGSHGIPAMAGSIYQGQASLLDQTELWN 775 \|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|#\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\| Query 716 SRPGYPSPRSSEGFYPSPQHMVQTNHYQVS#GYPGSHGIPAMAGSIYQGQASLLDQTELWN 775
Mus musculus	Query 716 SRPGYPSPRSSEGFYPSPQHMVQTNHYQVS#GYPGSHGIPAMAGSIYQGQASLLDQTELWN 775 \|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|#\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\| Query 716 SRPGYPSPRSSEGFYPSPQHMVQTNHYQVS#GYPGSHGIPAMAGSIYQGQASLLDQTELWN 775
Mus musculus	Query 716 SRPGYPSPRSSEGFYPSPQHMVQTNHYQVS#GYPGSHGIPAMAGSIYQGQASLLDQTELWN 775 \|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|#\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\| Query 716 SRPGYPSPRSSEGFYPSPQHMVQTNHYQVS#GYPGSHGIPAMAGSIYQGQASLLDQTELWN 775
Rattus norvegicus	Query 716 SRPGYPSPRSSEGFYPSPQHMVQTNHYQVS#GYPGSHGIPAMAGSIYQGQASLLDQTELWN 775 \|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|+\|#\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\| \|\|\|\|\|\|\|\|\|\|\|\|\| Sbjct 716 SRPGYPSPRSSEGFYPSPQHMVQTNHYQIS#GYPGSHGIPAMAGSIYPGQASLLDQTELWN 775
Canis familiaris	Query 716 SRPGYPSPRSSEGFYPSPQHMVQTNHYQVS#GYPGSHGIPAMAGSIYQGQASLLDQTELWN 775 \|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|#\|\|\| \|\|\|\|\|\|\|\|\|\|\|\| \|\|\|\|\|\|\|\|\|+ \|\| Sbjct 729 SRPGYPSPRSSEGFYPSPQHMVQTNHYQVS#GYPASHGIPAMAGSIYPGQASLLDQTDSWN 788
Homo sapiens	Query 716 SRPGYPSPRSSEGFYPSPQHMVQTNHYQVS#GYPGSHGIPAMAGSIYQGQASLLDQTELWN 775 \|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|#\|\|\|\|\|\|\|\| \|\|\|\|\|\|\| \|\|\|\|\|\|\|\|\|+ \|\| Sbjct 716 SRPGYPSPRSSEGFYPSPQHMVQTNHYQVS#GYPGSHGITAMAGSIYPGQASLLDQTDSWN 775
Gallus gallus	Query 716 SRPGYPSPRSSEGFYPSPQHMVQTNHYQVS#GYPGSHGIPAMAGSIYQGQASLLDQTELWN 775 \|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\| \|\|\|\|\|\|#\|\| \|\|\|\|\|\|\|\|\|\|\|\|\| \|\|\|\|\|\|\|\|\|+ \|\| Sbjct 716 SRPGYPSPRSSEGFYPSPQHMVQPNHYQVS#GYSGSHGIPAMAGSIYPGQASLLDQTDSWN 775
Xenopus tropicalis	Query 716 SRPGYPSPRSSEGFYPSPQHMVQTNHYQVS#GYPGSHGIPAMAGSIYQGQASLLDQTELWN 775 \|\|\|\|\|\|\|\|\|\|\|\|\|\|+\|\|\|\|\|\|\|\| \|\|\|\|\|\|#\|+ \|\|\|\|\|+\|+\|++\| \|\|\|\|++\| + \|\| Sbjct 716 SRPGYPSPRSSEGFFPSPQHMVQPNHYQVS#GFSISHGIPSMSGNLYPGQASVIDHMDSWN 775
Xenopus laevis	Query 716 SRPGYPSPRSSEGFYPSPQHMVQTNHYQVS#GYPGSHGIPAMAGSIYQGQASLLDQTELWN 775 \|\|\|\|\|\|\|\|\|\|\|\|\|\|+\|\|\|\|\|\|+\| \|\|\|\|\|\|#\|+ +\|\|\|\|+\|+\|++\| \|\|\|\|+\|\| + \|\| Sbjct 729 SRPGYPSPRSSEGFFPSPQHMMQPNHYQVS#GFSVAHGIPSMSGNMYPGQASVLDHMDSWN 788
Danio rerio	Query 716 SRPGYPSPRSSEGFYPSPQHMVQTNHYQVS#GYPGSHGIPAMAGSIYQGQASL--LDQTEL 773 \|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\| \| \|\|\|\|++#\|+ \| \|\|+ ++ \| +\| \|\|++ \|\| + Sbjct 718 SRPGYPSPRSSEGFYPSPQHMGQHNHYQMA#GHSGPHGLLSVPGGLYPPQATVTGLDPHDS 777 Query 774 WN 775 \|\| Query 774 WN 775
Tetraodon nigroviridis	Query 716 SRPGYPSPRSSEGFYPSPQHMVQTNHYQVS#GYPGSHGIPAMAGSIYQGQASLLDQTEL 773 \|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\| \|\| \|\|\|++#\|\|\|\| \| +\|++ ++\| \|++++ \| \| Sbjct 698 SRPGYPSPRSSEGFYPSSQH---PGHYQMA#GYPGPHTLPSVPSALYPQQSAMVTPTML 752
Methanococcus maripaludis S2	Query 732 SPQHMVQTNHYQVS#GYPGSHGIPAMAGSIYQGQASLLD 769 +\|+ ++ \|\|+\|+\| # \|\| \| +\|\|+\| \| + +\| Sbjct 121 TPERIIFTNNYEVF#SYPVVHSVPALAYVFKQVKKPRMD 158
Saccharomyces cerevisiae	Query 741 HYQVS#GYPGSH-GIPAMAGSIYQGQASLLDQTELWN 775 \|\|\|+# \| + \|+ + \| \|\|\|\|+++ +\|\|++\| Sbjct 987 RYQVT#LYAAQYAGLQTLLEKIKQGQAAIISKTEMFN 1022

* References

[PubMed ID: 24344130] Nguyen N, Yi JS, Park H, Lee JS, Ko YG, Mitsugumin 53 (MG53) ligase ubiquitinates focal adhesion kinase during skeletal myogenesis. J Biol Chem. 2014 Feb 7;289(6):3209-16. doi: 10.1074/jbc.M113.525154. Epub 2013

» More (9) « Hide Below

[PubMed ID: 24248601] ... Cheng SY, Sun G, Schlaepfer DD, Pallen CJ, Grb2 promotes integrin-induced focal adhesion kinase (FAK) autophosphorylation and directs the phosphorylation of protein tyrosine phosphatase alpha by the Src-FAK kinase complex. Mol Cell Biol. 2014 Feb;34(3):348-61. doi: 10.1128/MCB.00825-13. Epub 2013 Nov

[PubMed ID: 24446483] ... Jean C, Chen XL, Nam JO, Tancioni I, Uryu S, Lawson C, Ward KK, Walsh CT, Miller NL, Ghassemian M, Turowski P, Dejana E, Weis S, Cheresh DA, Schlaepfer DD, Inhibition of endothelial FAK activity prevents tumor metastasis by enhancing barrier function. J Cell Biol. 2014 Jan 20;204(2):247-63. doi: 10.1083/jcb.201307067.

[PubMed ID: 24089517] ... Malenczyk K, Jazurek M, Keimpema E, Silvestri C, Janikiewicz J, Mackie K, Di Marzo V, Redowicz MJ, Harkany T, Dobrzyn A, CB1 cannabinoid receptors couple to focal adhesion kinase to control insulin release. J Biol Chem. 2013 Nov 8;288(45):32685-99. doi: 10.1074/jbc.M113.478354. Epub 2013

[PubMed ID: 24080910] ... Perricone AJ, Bivona BJ, Jackson FR, Vander Heide RS, Conditional knockout of myocyte focal adhesion kinase abrogates ischemic preconditioning in adult murine hearts. J Am Heart Assoc. 2013 Sep 30;2(5):e000457. doi: 10.1161/JAHA.113.000457.

[PubMed ID: 16889663] ... Corsi JM, Rouer E, Girault JA, Enslen H, Organization and post-transcriptional processing of focal adhesion kinase gene. BMC Genomics. 2006 Aug 4;7:198.

[PubMed ID: 7478517] ... Furuta Y, Ilic D, Kanazawa S, Takeda N, Yamamoto T, Aizawa S, Mesodermal defect in late phase of gastrulation by a targeted mutation of focal adhesion kinase, FAK. Oncogene. 1995 Nov 16;11(10):1989-95.

[PubMed ID: 1458538] ... Zachary I, Rozengurt E, Focal adhesion kinase (p125FAK): a point of convergence in the action of neuropeptides, integrins, and oncogenes. Cell. 1992 Dec 11;71(6):891-4.

[PubMed ID: 1528852] ... Hanks SK, Calalb MB, Harper MC, Patel SK, Focal adhesion protein-tyrosine kinase phosphorylated in response to cell attachment to fibronectin. Proc Natl Acad Sci U S A. 1992 Sep 15;89(18):8487-91.

[PubMed ID: 2132399] ... Russell JC, Koeslag DG, Manickavel V, Amy RM, Dolphin PJ, Effects of advancing age and severe food restriction on pathological processes in the insulin resistant JCR:LA-corpulent rat. Diabetes Res. 1990 Oct;15(2):53-62.