CaMPDB :: Substrate

SB0125 : Transient receptor potential canonical 6, TRPC6

* Basic Information

Organism	Mus musculus (house mouse)
Protein Names	short transient receptor potential channel 6 isoform 1 [Mus musculus]; short transient receptor potential channel 6 isoform 1; short transient receptor potential channel 6; calcium entry channel; transient receptor protein 6; Short transient receptor potential channel 6; TrpC6; Calcium entry channel; Transient receptor protein 6; TRP-6
Gene Names	Trpc6; Trp6, Trrp6; Trp6; Trrp6; transient receptor potential cation channel, subfamily C, member 6
Gene Locus	9 2.46 cM; chromosome 9
GO Function	Not available

Entrez Protein	Entrez Nucleotide	Entrez Gene	UniProt	OMIM	HGNC	HPRD	KEGG
NP_038866	NM_013838	22068	Q61143	N/A	N/A	N/A	mmu:22068

* Information From OMIM

Not Available.

* Structure Information

1. Primary Information

Length: 930 aa

Average Mass: 106.680 kDa

Monoisotopic Mass: 106.612 kDa

2. Domain Information

Annotated Domains: interpro / pfam / smart / prosite

Computationally Assigned Domains (Pfam+HMMER):

domain name	begin	end	score	e-value
--- cleavage 16 ---
Ankyrin repeats (many copies) 1.	104	139	23.0	0.1
Ankyrin repeats (many copies) 2.	220	238	36.0	0.0
Inhibitor of growth proteins N-terminal histone-binding 1.	248	271	42.0	0.1
Cytochrome b562 1.	303	346	32.0	0.0
Polycystin cation channel 1.	490	733	210.0	14.0
Inhibitor of growth proteins N-terminal histone-binding 2.	796	830	47.0	0.5
Inhibitor of growth proteins N-terminal histone-binding 3.	853	921	29.0	1.5

3. Sequence Information

Fasta Sequence: SB0125.fasta

Amino Acid Sequence and Secondary Structures (PsiPred):

4. 3D Information

Not Available.

* Cleavage Information

1 [sites] cleaved by Calpain 1

Source Reference: [PubMed ID: 20811149] Du W, Huang J, Yao H, Zhou K, Duan B, Wang Y, Inhibition of TRPC6 degradation suppresses ischemic brain damage in rats. J Clin Invest. 2010 Oct;120(10):3480-92. doi: 10.1172/JCI43165. Epub 2010 Sep 1.

Cleavage sites (±10aa)

[Site 1] FVTRRGGSLK¹⁶-AAPGAGTRRN

Lys¹⁶ Ala

P10	P9	P8	P7	P6	P5	P4	P3	P2	P1

Phe⁷	Val⁸	Thr⁹	Arg¹⁰	Arg¹¹	Gly¹²	Gly¹³	Ser¹⁴	Leu¹⁵	Lys¹⁶

P1'	P2'	P3'	P4'	P5'	P6'	P7'	P8'	P9'	P10'
Ala¹⁷	Ala¹⁸	Pro¹⁹	Gly²⁰	Ala²¹	Gly²²	Thr²³	Arg²⁴	Arg²⁵	Asn²⁶

Sequence conservation (by blast) Sequence conservation (by blast)

Reference peptide (cleaved bond±30 residues)
MSQSPRFVTRRGGSLKAAPGAGTRRNESQDYLLMDELGDDGYPQLP

#	organism	max score	hits	top seq
1	Mus musculus	103.00	3	TRPC6_MOUSE Short transient receptor potential ch
2	Rattus norvegicus	92.80	1	transient receptor potential cation channel, subf
3	Homo sapiens	53.50	3	transient receptor potential cation channel, subf
4	Canis familiaris	38.50	1	PREDICTED: similar to transient receptor potentia
5	Nicotiana tabacum	30.40	1	MCM protein-like protein

organism	matching
Mus musculus	Query 1 MSQSPRFVTRRGGSLK#AAPGAGTRRNESQDYLLMDELGDDGYPQLP 46 \|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|#\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\| Query 1 MSQSPRFVTRRGGSLK#AAPGAGTRRNESQDYLLMDELGDDGYPQLP 46
Rattus norvegicus	Query 1 MSQSPRFVTRRGGSLK#AAPGAGTRRNESQDYLLMDELGDDGYPQL 45 \|\|\|\|\| \|\|\|\|\|\|\|\| \|#\|\|\|\|\|\| \|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\| Sbjct 1 MSQSPGFVTRRGGSPK#AAPGAGARRNESQDYLLMDELGDDGYPQL 45
Homo sapiens	Query 1 MSQSPRFVTRRGGSLK#AAPGAGTRRNESQDYLLMD-ELGDDGYPQLP 46 \|\|\|\|\| \| \|\|\| \| +# \| \|\| \|\|\|\|\|\|\|\|\|\|\|\| \|\|\|+\|\| \|\| \| Sbjct 1 MSQSPAFGPRRGSSPR#GAAGAAARRNESQDYLLMDSELGEDGCPQAP 47
Canis familiaris	Query 1 MSQSPRFVTRRGGSLK#AAPGAGTRRNESQDYLLMD-ELGDDGYPQLP 46 \|+\| \| \|\|\|\| +# \| \|\|\| \|\|\|+\|\|\|\|\|\|+\| \|\|\|\|\|\| \|\| \| Sbjct 168 MNQGRGFAPGRGGSPR#RAAGAGARRNQSQDYLLLDSELGDDGGPQPP 214
Nicotiana tabacum	Query 14 SLK#AAPGAGTRRNESQDYLLMDELGDDGY 42 ++ #++\|\|\| \| \| \|\|\| + \|+ \|\| \| Sbjct 86 AMP#SSPGASQRVNSSQDVPMTDQTDDDAY 114

* References

[PubMed ID: 24462772] Albarran L, Berna-Erro A, Dionisio N, Redondo PC, Lopez E, Lopez JJ, Salido GM, Brull Sabate JM, Rosado JA, TRPC6 participates in the regulation of cytosolic basal calcium concentration in murine resting platelets. Biochim Biophys Acta. 2014 Apr;1843(4):789-96. doi: 10.1016/j.bbamcr.2014.01.014.

» More (9) « Hide Below

[PubMed ID: 24449818] ... Seo K, Rainer PP, Lee DI, Hao S, Bedja D, Birnbaumer L, Cingolani OH, Kass DA, Hyperactive adverse mechanical stress responses in dystrophic heart are coupled to transient receptor potential canonical 6 and blocked by cGMP-protein kinase G modulation. Circ Res. 2014 Feb 28;114(5):823-32. doi: 10.1161/CIRCRESAHA.114.302614. Epub

[PubMed ID: 24453217] ... Seo K, Rainer PP, Shalkey Hahn V, Lee DI, Jo SH, Andersen A, Liu T, Xu X, Willette RN, Lepore JJ, Marino JP Jr, Birnbaumer L, Schnackenberg CG, Kass DA, Combined TRPC3 and TRPC6 blockade by selective small-molecule or genetic deletion inhibits pathological cardiac hypertrophy. Proc Natl Acad Sci U S A. 2014 Jan 28;111(4):1551-6. doi:

[PubMed ID: 24144647] ... Xia Y, Yang XR, Fu Z, Paudel O, Abramowitz J, Birnbaumer L, Sham JS, Classical transient receptor potential 1 and 6 contribute to hypoxic pulmonary hypertension through differential regulation of pulmonary vascular functions. Hypertension. 2014 Jan;63(1):173-80. doi: 10.1161/HYPERTENSIONAHA.113.01902. Epub

[PubMed ID: 24194522] ... Kistler AD, Singh G, Altintas MM, Yu H, Fernandez IC, Gu C, Wilson C, Srivastava SK, Dietrich A, Walz K, Kerjaschki D, Ruiz P, Dryer S, Sever S, Dinda AK, Faul C, Reiser J, Transient receptor potential channel 6 (TRPC6) protects podocytes during complement-mediated glomerular disease. J Biol Chem. 2013 Dec 20;288(51):36598-609. doi: 10.1074/jbc.M113.488122. Epub

[PubMed ID: 10998353] ... Hofmann T, Schaefer M, Schultz G, Gudermann T, Cloning, expression and subcellular localization of two novel splice variants of mouse transient receptor potential channel 2. Biochem J. 2000 Oct 1;351(Pt 1):115-22.

[PubMed ID: 10050885] ... Buess M, Engler O, Hirsch HH, Moroni C, Search for oncogenic regulators in an autocrine tumor model using differential display PCR: identification of novel candidate genes including the calcium channel mtrp6. Oncogene. 1999 Feb 18;18(7):1487-94.

[PubMed ID: 9722956] ... Yamazaki K, Okada T, Mori Y, Tanaka I, Genetic mapping of mouse transient receptor potential (Trrp) genes responsible for capacitative calcium entry channels to chromosomes 3, 7, 9, and X. Genomics. 1998 Jul 15;51(2):303-5.

[PubMed ID: 9368034] ... Boulay G, Zhu X, Peyton M, Jiang M, Hurst R, Stefani E, Birnbaumer L, Cloning and expression of a novel mammalian homolog of Drosophila transient receptor potential (Trp) involved in calcium entry secondary to activation of receptors coupled by the Gq class of G protein. J Biol Chem. 1997 Nov 21;272(47):29672-80.

[PubMed ID: 8646775] ... Zhu X, Jiang M, Peyton M, Boulay G, Hurst R, Stefani E, Birnbaumer L, trp, a novel mammalian gene family essential for agonist-activated capacitative Ca2+ entry. Cell. 1996 May 31;85(5):661-71.