XSB1022 : PREDICTED: similar to Peroxiredoxin-2 (Thioredoxin peroxidase 1) (Thioredoxin-dependent peroxide reductase 1) (Thiol-specific antioxidant protein) (TSA) (PRP) (Natural killer cell-enhancing factor B) (NKEF-B) [Monodelphis domestica]
[ CaMP Format ]
This entry is computationally expanded from SB0091
* Basic Information
| Organism | Monodelphis domestica (gray short-tailed opossum) |
| Protein Names | similar to Peroxiredoxin-2 (Thioredoxin peroxidase 1) (Thioredoxin-dependent peroxide reductase 1) (Thiol-specific antioxidant protein) (TSA) (PRP) (Natural killer cell-enhancing factor B) (NKEF-B) |
| Gene Names | LOC100009798; Derived by automated computational analysis using gene prediction method: GNOMON. Supporting evidence includes similarity to: 19 Proteins |
| Gene Locus | Not available |
| GO Function | Not available |
| Entrez Protein | Entrez Nucleotide | Entrez Gene | UniProt | OMIM | HGNC | HPRD | KEGG |
|---|---|---|---|---|---|---|---|
| XP_001362118 | XM_001362081 | 100009798 | N/A | N/A | N/A | N/A | N/A |
* Information From OMIM
Not Available.
* Structure Information
1. Primary Information
Length: 198 aa
Average Mass: 21.967 kDa
Monoisotopic Mass: 21.953 kDa
2. Domain Information
Annotated Domains: Not Available.
Computationally Assigned Domains (Pfam+HMMER):
| domain name | begin | end | score | e-value |
|---|---|---|---|---|
| AhpC-TSA 1. | 8 | 141 | 208.9 | 1.4e-59 |
| 1-cysPrx_C 1. | 151 | 194 | 88.9 | 1.8e-23 |
| --- cleavage 181 (inside 1-cysPrx_C 151..194) --- | ||||
| --- cleavage 193 (inside 1-cysPrx_C 151..194) --- | ||||
| --- cleavage 183 (inside 1-cysPrx_C 151..194) --- | ||||
| --- cleavage 182 (inside 1-cysPrx_C 151..194) --- | ||||
| --- cleavage 194 (inside 1-cysPrx_C 151..194) --- | ||||
3. Sequence Information
Fasta Sequence: XSB1022.fasta
Amino Acid Sequence and Secondary Structures (PsiPred):
4. 3D Information
Not Available.
* Cleavage Information
5 [sites]
Cleavage sites (±10aa)
[Site 1] CPAGWKPGGD181-TIKPNVEDSK
Asp181 
Thr
 |
|||||||||
| P10 | P9 | P8 | P7 | P6 | P5 | P4 | P3 | P2 | P1 |
|---|---|---|---|---|---|---|---|---|---|
| Cys172 | Pro173 | Ala174 | Gly175 | Trp176 | Lys177 | Pro178 | Gly179 | Gly180 | Asp181 |
 |
|||||||||
| P1' | P2' | P3' | P4' | P5' | P6' | P7' | P8' | P9' | P10' |
| Thr182 | Ile183 | Lys184 | Pro185 | Asn186 | Val187 | Glu188 | Asp189 | Ser190 | Lys191 |
Sequence conservation (by blast)
Sequence conservation (by blast)
| Reference peptide (cleaved bond±30 residues) |
|---|
| VDETLRLVQAFQYTDEHGEVCPAGWKPGGDTIKPNVEDSKEYFSKNN |
Summary
| # | organism | max score | hits | top seq |
|---|---|---|---|---|
| 1 | N/A | 104.00 | 16 | - |
| 2 | Mus musculus | 97.40 | 16 | Prdx2 protein |
| 3 | Homo sapiens | 97.40 | 15 | peroxiredoxin 2 isoform a |
| 4 | Macaca mulatta | 97.40 | 8 | PREDICTED: peroxiredoxin 2 isoform 2 |
| 5 | synthetic construct | 97.40 | 8 | peroxiredoxin 2 |
| 6 | Rattus norvegicus | 97.40 | 7 | peroxiredoxin 2 |
| 7 | Cricetulus griseus | 97.40 | 2 | PRDX2_CRIGR Peroxiredoxin-2 gb |
| 8 | Bos taurus | 95.10 | 5 | peroxiredoxin 2 |
| 9 | Xenopus tropicalis | 89.70 | 4 | peroxiredoxin 2 |
| 10 | Branchiostoma belcheri tsingtaunese | 89.40 | 1 | thioredoxin peroxidase |
| 11 | Canis familiaris | 89.00 | 9 | PREDICTED: similar to peroxiredoxin 1 |
| 12 | Pan troglodytes | 89.00 | 6 | PREDICTED: similar to proliferation associated gen |
| 13 | Gallus gallus | 89.00 | 6 | PREDICTED: similar to natural killer cell enhancin |
| 14 | Macaca fascicularis | 89.00 | 3 | unnamed protein product |
| 15 | Myotis lucifugus | 89.00 | 1 | PRDX1_MYOLU Peroxiredoxin-1 gb |
| 16 | Monodelphis domestica | 88.20 | 3 | PREDICTED: similar to proliferation associated gen |
| 17 | Gekko japonicus | 87.80 | 1 | PRDX1_GECJA Peroxiredoxin-1 gb |
| 18 | Xenopus laevis | 87.40 | 7 | MGC83078 protein |
| 19 | Ixodes scapularis | 87.40 | 3 | thioredoxin peroxidase |
| 20 | Cyprinus carpio | 87.40 | 1 | natural killer cell enhancing factor |
| 21 | Ictalurus punctatus | 87.40 | 1 | natural killer cell enhancing factor |
| 22 | Danio rerio | 87.00 | 5 | hypothetical protein LOC541344 |
| 23 | Ciona intestinalis | 87.00 | 1 | peroxiredoxin-like |
| 24 | Tetraodon nigroviridis | 86.30 | 3 | unnamed protein product |
| 25 | Spermophilus tridecemlineatus | 86.30 | 1 | peroxiredoxin 2 |
| 26 | Oncorhynchus mykiss | 86.30 | 1 | AF250193_1 natural killer cell enhancement factor |
| 27 | Ostertagia ostertagi | 85.90 | 1 | thioredoxin peroxidase |
| 28 | Drosophila melanogaster | 85.10 | 4 | thioredoxin peroxidase 2 CG1274-PA, isoform A |
| 29 | Aedes aegypti | 84.70 | 3 | peroxiredoxins, prx-1, prx-2, prx-3 |
| 30 | Paralichthys olivaceus | 84.70 | 1 | natural killer enhancing factor |
| 31 | Haemonchus contortus | 84.30 | 1 | peroxiredoxin |
| 32 | Anopheles gambiae str. PEST | 84.00 | 3 | ENSANGP00000010951 |
| 33 | Cynops pyrrhogaster | 84.00 | 1 | TDX_CYNPY Peroxiredoxin (Thioredoxin peroxidase) ( |
| 34 | Drosophila pseudoobscura | 83.20 | 3 | GA11781-PA |
| 35 | Caenorhabditis elegans | 80.90 | 2 | PeRoxireDoXin family member (prdx-2) |
| 36 | Apis mellifera | 80.90 | 2 | PREDICTED: similar to thioredoxin peroxidase 1 CG1 |
| 37 | Scophthalmus maximus | 80.90 | 1 | natural killer enhancing factor |
| 38 | Artemia franciscana | 80.90 | 1 | thioredoxin peroxidase |
| 39 | Strongylocentrotus purpuratus | 80.50 | 3 | PREDICTED: similar to thioredoxin peroxidase |
| 40 | Onchocerca volvulus | 80.50 | 2 | peroxidoxin-2 |
| 41 | Caenorhabditis briggsae | 80.10 | 2 | Hypothetical protein CBG02380 |
| 42 | Onchocerca ochengi | 80.10 | 1 | peroxidoxin-2 |
| 43 | Biomphalaria glabrata | 79.00 | 1 | thioredoxin peroxidase BgTPx |
| 44 | Ascaris suum | 79.00 | 1 | PRDX_ASCSU Peroxiredoxin (AsPrx) (Thioredoxin pero |
| 45 | Tribolium castaneum | 78.20 | 4 | PREDICTED: similar to Peroxiredoxin-4 (Prx-IV) (Th |
| 46 | Bombyx mori | 78.20 | 2 | thioredoxin peroxidase |
| 47 | Dirofilaria immitis | 75.90 | 2 | thioredoxin peroxidase |
| 48 | Globodera rostochiensis | 75.50 | 1 | peroxiredoxin |
| 49 | Acanthocheilonema viteae | 75.10 | 1 | thiredoxin peroxidase |
| 50 | Debaryomyces hansenii CBS767 | 74.30 | 1 | hypothetical protein DEHA0G11154g |
| 51 | Pichia guilliermondii ATCC 6260 | 73.90 | 1 | peroxiredoxin TSA1 |
| 52 | Paramecium tetraurelia | 73.20 | 8 | hypothetical protein |
| 53 | Toxoptera citricida | 73.20 | 1 | putative cytosolic thioredoxin peroxidase |
| 54 | Apis mellifera ligustica | 72.80 | 1 | thioredoxin peroxidase |
| 55 | Trypanosoma cruzi strain CL Brener | 72.40 | 4 | tryparedoxin peroxidase |
| 56 | Glossina morsitans morsitans | 72.40 | 3 | putative thioredoxin peroxidase 2 |
| 57 | Schistosoma japonicum | 72.40 | 1 | SJCHGC01281 protein |
| 58 | Schistosoma mansoni | 72.40 | 1 | AF301001_1 thioredoxin peroxidase 3 |
| 59 | Pichia stipitis CBS 6054 | 72.40 | 1 | Peroxiredoxin TSA1 |
| 60 | Candida albicans SC5314 | 71.60 | 1 | putative thioredoxin peroxidase |
| 61 | Lodderomyces elongisporus NRRL YB-4239 | 71.60 | 1 | peroxiredoxin TSA1 |
| 62 | Pongo pygmaeus | 70.90 | 1 | PRDX3_PONPY Thioredoxin-dependent peroxide reducta |
| 63 | Amoeba proteus | 70.50 | 1 | peroxiredoxin |
| 64 | Litomosoides sigmodontis | 70.10 | 1 | AF105258_1 peroxidoxin-2 |
| 65 | Taiwanofungus camphoratus | 69.30 | 1 | peroxiredoxin |
| 66 | Yarrowia lipolytica | 69.30 | 1 | hypothetical protein |
| 67 | Maconellicoccus hirsutus | 69.30 | 1 | putative cytosolic thioredoxin peroxidase |
| 68 | Trypanosoma cruzi | 68.90 | 1 | AF320771_1 tryparedoxin peroxidase |
| 69 | Trypanosoma brucei TREU927 | 68.60 | 2 | tryparedoxin peroxidase |
| 70 | Ostreococcus lucimarinus CCE9901 | 68.60 | 1 | predicted protein |
| 71 | Phaeosphaeria nodorum SN15 | 68.60 | 1 | hypothetical protein SNOG_00334 |
| 72 | Saccharomyces cerevisiae | 68.60 | 1 | Tsa1p |
| 73 | Gibberella zeae PH-1 | 67.80 | 1 | hypothetical protein FG03180.1 |
| 74 | Ostreococcus tauri | 67.00 | 1 | thioredoxin I (ISS) |
| 75 | Drosophila yakuba | 67.00 | 1 | similar to Drosophila melanogaster Jafrac1 |
| 76 | Candida glabrata | 66.60 | 2 | unnamed protein product |
| 77 | Moniliophthora perniciosa | 65.90 | 1 | cys 2 peroxiredoxin |
| 78 | Taenia solium | 65.90 | 1 | 2-Cys peroxiredoxin |
| 79 | Echinococcus granulosus | 65.50 | 2 | TDX_ECHGR Thioredoxin peroxidase (Peroxiredoxin) ( |
| 80 | Echinococcus multilocularis | 64.70 | 1 | thioredoxin peroxidase |
| 81 | Tetrahymena thermophila SB210 | 63.90 | 3 | AhpC/TSA family protein |
| 82 | Entamoeba moshkovskii | 63.90 | 3 | peroxiredoxin |
| 83 | Phanerochaete chrysosporium | 63.90 | 1 | peroxiredoxins |
| 84 | Trichomonas vaginalis G3 | 63.50 | 4 | thioredoxin peroxidase |
| 85 | Oryza sativa (japonica cultivar-group) | 63.20 | 2 | OJ991214_12.15 |
| 86 | Oryza sativa (indica cultivar-group) | 63.20 | 1 | hypothetical protein OsI_015300 |
| 87 | Nitrosococcus oceani ATCC 19707 | 63.20 | 1 | Alkyl hydroperoxide reductase/ Thiol specific anti |
| 88 | Spinacia oleracea | 62.80 | 1 | BAS1_SPIOL 2-Cys peroxiredoxin BAS1, chloroplast p |
| 89 | Kluyveromyces lactis | 62.80 | 1 | unnamed protein product |
| 90 | Ashbya gossypii ATCC 10895 | 62.80 | 1 | AER312Wp |
| 91 | Brugia malayi | 62.40 | 1 | TDX1_BRUMA Thioredoxin peroxidase 1 (Peroxiredoxin |
| 92 | Hordeum vulgare subsp. vulgare | 62.00 | 1 | BAS1_HORVU 2-Cys peroxiredoxin BAS1, chloroplast p |
| 93 | Cryptococcus neoformans var. neoformans JEC21 | 62.00 | 1 | thioredoxin-dependent peroxide reductase |
| 94 | Cryptococcus neoformans var. grubii | 62.00 | 1 | thiol-specific antioxidant protein 1 |
| 95 | Leptospira borgpetersenii serovar Hardjo-bovis L550 | 61.60 | 1 | Peroxiredoxin |
| 96 | Chlorobium ferrooxidans DSM 13031 | 61.20 | 1 | Alkyl hydroperoxide reductase/ Thiol specific anti |
| 97 | Prochlorococcus marinus str. NATL2A | 61.20 | 1 | thioredoxin peroxidase |
| 98 | Synechococcus sp. BL107 | 60.80 | 1 | thioredoxin peroxidase |
Top-ranked sequences
| organism | matching |
|---|---|
| N/A | Query 152 VDETLRLVQAFQYTDEHGEVCPAGWKPGGD#TIKPNVEDSKEYFSKNN 198 ||||||||||||||||||||||||||||||#||||||||||||||||| Query 152 VDETLRLVQAFQYTDEHGEVCPAGWKPGGD#TIKPNVEDSKEYFSKNN 198 |
| Mus musculus | Query 152 VDETLRLVQAFQYTDEHGEVCPAGWKPGGD#TIKPNVEDSKEYFSKNN 198 ||| |||||||||||||||||||||||| |#||||||+||||||||+| Sbjct 152 VDEALRLVQAFQYTDEHGEVCPAGWKPGSD#TIKPNVDDSKEYFSKHN 198 |
| Homo sapiens | Query 152 VDETLRLVQAFQYTDEHGEVCPAGWKPGGD#TIKPNVEDSKEYFSKNN 198 ||| |||||||||||||||||||||||| |#||||||+||||||||+| Sbjct 152 VDEALRLVQAFQYTDEHGEVCPAGWKPGSD#TIKPNVDDSKEYFSKHN 198 |
| Macaca mulatta | Query 152 VDETLRLVQAFQYTDEHGEVCPAGWKPGGD#TIKPNVEDSKEYFSKNN 198 ||| |||||||||||||||||||||||| |#||||||+||||||||+| Sbjct 102 VDEALRLVQAFQYTDEHGEVCPAGWKPGSD#TIKPNVDDSKEYFSKHN 148 |
| synthetic construct | Query 152 VDETLRLVQAFQYTDEHGEVCPAGWKPGGD#TIKPNVEDSKEYFSKNN 198 ||| |||||||||||||||||||||||| |#||||||+||||||||+| Sbjct 152 VDEALRLVQAFQYTDEHGEVCPAGWKPGSD#TIKPNVDDSKEYFSKHN 198 |
| Rattus norvegicus | Query 152 VDETLRLVQAFQYTDEHGEVCPAGWKPGGD#TIKPNVEDSKEYFSKNN 198 ||| |||||||||||||||||||||||| |#||||||+||||||||+| Sbjct 152 VDEALRLVQAFQYTDEHGEVCPAGWKPGSD#TIKPNVDDSKEYFSKHN 198 |
| Cricetulus griseus | Query 152 VDETLRLVQAFQYTDEHGEVCPAGWKPGGD#TIKPNVEDSKEYFSKNN 198 ||| |||||||||||||||||||||||| |#||||||+||||||||+| Sbjct 152 VDEALRLVQAFQYTDEHGEVCPAGWKPGSD#TIKPNVDDSKEYFSKHN 198 |
| Bos taurus | Query 152 VDETLRLVQAFQYTDEHGEVCPAGWKPGGD#TIKPNVEDSKEYFSKNN 198 ||| ||||||||||||||||||||| || |#||||||+||||||||+| Sbjct 153 VDEALRLVQAFQYTDEHGEVCPAGWTPGSD#TIKPNVDDSKEYFSKHN 199 |
| Xenopus tropicalis | Query 152 VDETLRLVQAFQYTDEHGEVCPAGWKPGGD#TIKPNVEDSKEYFSK 196 |+|||||||||||||+|||||||||||| #||||||+||||+||| Sbjct 160 VEETLRLVQAFQYTDQHGEVCPAGWKPGSS#TIKPNVKDSKEFFSK 204 |
| Branchiostoma belcheri tsingtaunese | Query 152 VDETLRLVQAFQYTDEHGEVCPAGWKPGGD#TIKPNVEDSKEYFSK 196 ||||||||||||+||+|||||||||||| |#||||+|++||||||| Sbjct 153 VDETLRLVQAFQFTDKHGEVCPAGWKPGAD#TIKPDVKNSKEYFSK 197 |
| Canis familiaris | Query 152 VDETLRLVQAFQYTDEHGEVCPAGWKPGGD#TIKPNVEDSKEYFSK 196 ||||||||||||+||+|||||||||||| |#||||+|+ ||||||| Sbjct 153 VDETLRLVQAFQFTDKHGEVCPAGWKPGSD#TIKPDVQKSKEYFSK 197 |
| Pan troglodytes | Query 152 VDETLRLVQAFQYTDEHGEVCPAGWKPGGD#TIKPNVEDSKEYFSK 196 ||||||||||||+||+|||||||||||| |#||||+|+ ||||||| Sbjct 102 VDETLRLVQAFQFTDKHGEVCPAGWKPGSD#TIKPDVQKSKEYFSK 146 |
| Gallus gallus | Query 152 VDETLRLVQAFQYTDEHGEVCPAGWKPGGD#TIKPNVEDSKEYFSK 196 ||||||||||||+||+|||||||||||| |#||||+|+ ||||||| Sbjct 153 VDETLRLVQAFQFTDKHGEVCPAGWKPGSD#TIKPDVQKSKEYFSK 197 |
| Macaca fascicularis | Query 152 VDETLRLVQAFQYTDEHGEVCPAGWKPGGD#TIKPNVEDSKEYFSK 196 ||||||||||||+||+|||||||||||| |#||||+|+ ||||||| Sbjct 149 VDETLRLVQAFQFTDKHGEVCPAGWKPGSD#TIKPDVQKSKEYFSK 193 |
| Myotis lucifugus | Query 152 VDETLRLVQAFQYTDEHGEVCPAGWKPGGD#TIKPNVEDSKEYFSK 196 ||||||||||||+||+|||||||||||| |#||||+|+ ||||||| Sbjct 153 VDETLRLVQAFQFTDKHGEVCPAGWKPGSD#TIKPDVQKSKEYFSK 197 |
| Monodelphis domestica | Query 152 VDETLRLVQAFQYTDEHGEVCPAGWKPGGD#TIKPNVEDSKEYFSKNN 198 |||||||+||||+||++||||||||||| |#||||+|+ ||||||| | Sbjct 153 VDETLRLIQAFQFTDKYGEVCPAGWKPGSD#TIKPDVKGSKEYFSKQN 199 |
| Gekko japonicus | Query 152 VDETLRLVQAFQYTDEHGEVCPAGWKPGGD#TIKPNVEDSKEYFSKN 197 ||||||||||||+||+|||||||||+|| |#||||+|+ |||||||+ Sbjct 153 VDETLRLVQAFQFTDKHGEVCPAGWQPGSD#TIKPDVQKSKEYFSKH 198 |
| Xenopus laevis | Query 152 VDETLRLVQAFQYTDEHGEVCPAGWKPGGD#TIKPNVEDSKEYFSK 196 ||||||||||||||| |||||||||||| # |||||+||||+||| Sbjct 156 VDETLRLVQAFQYTDVHGEVCPAGWKPGSS#IIKPNVKDSKEFFSK 200 |
| Ixodes scapularis | Query 152 VDETLRLVQAFQYTDEHGEVCPAGWKPGGD#TIKPNVEDSKEYFSK 196 |||||||||||||||+||||||||||||||#|| || || +|||| Sbjct 203 VDETLRLVQAFQYTDKHGEVCPAGWKPGGD#TIIPNPEDKLKYFSK 247 |
| Cyprinus carpio | Query 152 VDETLRLVQAFQYTDEHGEVCPAGWKPGGD#TIKPNVEDSKEYFSKNN 198 +|||||||||||+||+|||||||||||| |#||||+|+ ||+|||| + Sbjct 153 IDETLRLVQAFQFTDKHGEVCPAGWKPGKD#TIKPDVQQSKDYFSKQH 199 |
| Ictalurus punctatus | Query 152 VDETLRLVQAFQYTDEHGEVCPAGWKPGGD#TIKPNVEDSKEYFSKNN 198 +|||||||||||+||+|||||||||||| |#||||+|+ ||++||| | Sbjct 153 IDETLRLVQAFQFTDKHGEVCPAGWKPGKD#TIKPDVQKSKDFFSKQN 199 |
| Danio rerio | Query 152 VDETLRLVQAFQYTDEHGEVCPAGWKPGGD#TIKPNVEDSKEYFSKNN 198 +|||||||||||+||+|||||||||||| |#||||+| ||++||| | Sbjct 153 IDETLRLVQAFQFTDKHGEVCPAGWKPGKD#TIKPDVNQSKDFFSKQN 199 |
| Ciona intestinalis | Query 152 VDETLRLVQAFQYTDEHGEVCPAGWKPGGD#TIKPNVEDSKEYFSK 196 ||||||||+|||+||+|||||||||||| |#||||+|+||++|||| Sbjct 152 VDETLRLVKAFQFTDQHGEVCPAGWKPGDD#TIKPDVQDSQKYFSK 196 |
| Tetraodon nigroviridis | Query 152 VDETLRLVQAFQYTDEHGEVCPAGWKPGGD#TIKPNVEDSKEYFSKN 197 |+||||||||||+||+|||||||||||| |#||||+|+ |||+|||+ Sbjct 153 VEETLRLVQAFQFTDKHGEVCPAGWKPGSD#TIKPDVQKSKEFFSKH 198 |
| Spermophilus tridecemlineatus | Query 152 VDETLRLVQAFQYTDEHGEVCPAGWKPGGD#TIKPNVEDSKE 192 ||| |||||||||||||||||||||||| |#||||||+|||| Sbjct 61 VDEALRLVQAFQYTDEHGEVCPAGWKPGSD#TIKPNVDDSKE 101 |
| Oncorhynchus mykiss | Query 152 VDETLRLVQAFQYTDEHGEVCPAGWKPGGD#TIKPNVEDSKEYFSK 196 ||||||||||||+||+|||||||||||| |#||||+|+ ||++||| Sbjct 153 VDETLRLVQAFQFTDKHGEVCPAGWKPGSD#TIKPDVQKSKDFFSK 197 |
| Ostertagia ostertagi | Query 152 VDETLRLVQAFQYTDEHGEVCPAGWKPGGD#TIKPNVEDSKEYFSKNN 198 ||||||||||||| |+||||||||| || #|||| |+|||||||| | Sbjct 147 VDETLRLVQAFQYVDKHGEVCPAGWTPGKA#TIKPGVKDSKEYFSKAN 193 |
| Drosophila melanogaster | Query 152 VDETLRLVQAFQYTDEHGEVCPAGWKPGGD#TIKPNVEDSKEYFSKNN 198 ||||+|||||||||| |||||||||+|| |#|| || |+ +||+||| Sbjct 196 VDETIRLVQAFQYTDTHGEVCPAGWRPGAD#TIVPNPEEKTKYFAKNN 242 |
| Aedes aegypti | Query 152 VDETLRLVQAFQYTDEHGEVCPAGWKPGGD#TIKPNVEDSKEYFSKNN 198 |||||||||||||||+|||||||||||| |#|| || |+ +|| ||+ Sbjct 209 VDETLRLVQAFQYTDKHGEVCPAGWKPGQD#TIVPNPEEKMKYFEKNH 255 |
| Paralichthys olivaceus | Query 152 VDETLRLVQAFQYTDEHGEVCPAGWKPGGD#TIKPNVEDSKEYFSK 196 |+||||||||||+||+|||||||||||| |#||||+|+ ||++||| Sbjct 153 VEETLRLVQAFQFTDKHGEVCPAGWKPGSD#TIKPDVQKSKDFFSK 197 |
| Haemonchus contortus | Query 152 VDETLRLVQAFQYTDEHGEVCPAGWKPGGD#TIKPNVEDSKEYFSKNN 198 ||||||||||||| |+||||||||| || +#|||| |++|+||||| | Sbjct 150 VDETLRLVQAFQYVDKHGEVCPAGWTPGKE#TIKPRVKESQEYFSKAN 196 |
| Anopheles gambiae str. PEST | Query 152 VDETLRLVQAFQYTDEHGEVCPAGWKPGGD#TIKPNVEDSKEYFSKNN 198 |||||||||||||||+|||||||||||| |#|| || |+ +|| ||+ Sbjct 204 VDETLRLVQAFQYTDKHGEVCPAGWKPGQD#TIVPNPEEKIKYFEKNH 250 |
| Cynops pyrrhogaster | Query 152 VDETLRLVQAFQYTDEHGEVCPAGWKPGGD#TIKPNVEDSKEYFSK 196 ||||||||||||+||+ ||||||||||| |#||||++ ||||||| Sbjct 153 VDETLRLVQAFQHTDKFGEVCPAGWKPGSD#TIKPDISKSKEYFSK 197 |
| Drosophila pseudoobscura | Query 152 VDETLRLVQAFQYTDEHGEVCPAGWKPGGD#TIKPNVEDSKEYFSKNN 198 ||||+|||||||||| |||||||||+|| |#|| |+ |+ +||+||| Sbjct 197 VDETIRLVQAFQYTDTHGEVCPAGWRPGAD#TIVPDPEEKTKYFAKNN 243 |
| Caenorhabditis elegans | Query 152 VDETLRLVQAFQYTDEHGEVCPAGWKPGGD#TIKPNVEDSKEYFSKN 197 ||||||||||||+ ++||||||||| || |#|||| |++|+||| |+ Sbjct 150 VDETLRLVQAFQFVEKHGEVCPAGWTPGSD#TIKPGVKESQEYFKKH 195 |
| Apis mellifera | Query 152 VDETLRLVQAFQYTDEHGEVCPAGWKPGGD#TIKPNVEDSKEYF 194 |||||||||||||||+|||||||||||| #|+||+| ||||| Sbjct 149 VDETLRLVQAFQYTDKHGEVCPAGWKPGKK#TMKPDVVGSKEYF 191 |
| Scophthalmus maximus | Query 152 VDETLRLVQAFQYTDEHGEVCPAGWKPGGD#TIKPNVEDSKEYFSK 196 |||+|||+||||+||+|||||||||||| |#|| |+|| || +||| Sbjct 152 VDESLRLIQAFQHTDKHGEVCPAGWKPGSD#TIIPDVEKSKAFFSK 196 |
| Artemia franciscana | Query 152 VDETLRLVQAFQYTDEHGEVCPAGWKPGGD#TIKPNVEDSKEYFSKNN 198 |||||||||||||||+|||||||||||| |#|| |+ | +|| | | Sbjct 197 VDETLRLVQAFQYTDKHGEVCPAGWKPGSD#TIVPHPTDKLKYFGKLN 243 |
| Strongylocentrotus purpuratus | Query 152 VDETLRLVQAFQYTDEHGEVCPAGWKPGGD#TIKPNVEDSKEYFSK 196 ||| ||||||||+||+ ||||||||||| |#|||| |++|||+| | Sbjct 152 VDEVLRLVQAFQFTDKFGEVCPAGWKPGDD#TIKPGVKESKEFFGK 196 |
| Onchocerca volvulus | Query 152 VDETLRLVQAFQYTDEHGEVCPAGWKPGGD#TIKPNVEDSKEYFSKN 197 ||||||||||||+ | ||||||| |+|| +#|||| |++||||| |+ Sbjct 154 VDETLRLVQAFQFVDNHGEVCPANWQPGSE#TIKPEVKESKEYFGKH 199 |
| Caenorhabditis briggsae | Query 152 VDETLRLVQAFQYTDEHGEVCPAGWKPGGD#TIKPNVEDSKEYFSKN 197 ||||||||||||+ ++||||||||| || |#||||+|+ |+||| |+ Sbjct 530 VDETLRLVQAFQFVEKHGEVCPAGWTPGSD#TIKPDVKKSQEYFGKH 575 |
| Onchocerca ochengi | Query 152 VDETLRLVQAFQYTDEHGEVCPAGWKPGGD#TIKPNVEDSKEYFSKN 197 |||||||+||||+ | ||||||| |+|| +#|||| |++||||| |+ Sbjct 154 VDETLRLIQAFQFVDNHGEVCPANWQPGSE#TIKPEVKESKEYFGKH 199 |
| Biomphalaria glabrata | Query 152 VDETLRLVQAFQYTDEHGEVCPAGWKPGGD#TIKPNVEDSKEYFSKNN 198 |||||||||||||||+|||||||||||| #|| |+ + ||||| + + Sbjct 173 VDETLRLVQAFQYTDKHGEVCPAGWKPGSA#TIIPDPKKSKEYFKQQS 219 |
| Ascaris suum | Query 152 VDETLRLVQAFQYTDEHGEVCPAGWKPGGD#TIKPNVEDSKEYFSKN 197 | ||||||||||+ |+||||||||| || |#|||| |++|| || |+ Sbjct 150 VTETLRLVQAFQFVDKHGEVCPAGWTPGAD#TIKPGVKESKAYFEKH 195 |
| Tribolium castaneum | Query 152 VDETLRLVQAFQYTDEHGEVCPAGWKPGGD#TIKPNVEDSKEYFSKN 197 |||||||||||||||+||||||| |||| |#|| || + |+|| |+ Sbjct 198 VDETLRLVQAFQYTDKHGEVCPAEWKPGQD#TIIPNPIEKKKYFEKH 243 |
| Bombyx mori | Query 152 VDETLRLVQAFQYTDEHGEVCPAGWKP--GGD#TIKPNVEDSKEYFSKNN 198 ||||||||+|||+ |+||||||||| | |#||||| +|||||| | | Sbjct 179 VDETLRLVKAFQFADKHGEVCPAGWNPDTNAD#TIKPNPKDSKEYFQKAN 227 |
| Dirofilaria immitis | Query 152 VDETLRLVQAFQYTDEHGEVCPAGWKPGGD#TIKPNVEDSKEYFSKN 197 |||||||+||||+ | ||||||| |+|| +# ||| |++|| || |+ Sbjct 154 VDETLRLIQAFQFVDNHGEVCPANWQPGSE#AIKPGVKESKAYFEKH 199 |
| Globodera rostochiensis | Query 152 VDETLRLVQAFQYTDEHGEVCPAGWKPGGD#TIKPNVEDSKEYFSK 196 |||||||||||+||| ||||||| |+|| |#||||+ | |+ +| | Sbjct 153 VDETLRLVQAFKYTDTHGEVCPANWQPGED#TIKPDPEGSQTFFGK 197 |
| Acanthocheilonema viteae | Query 152 VDETLRLVQAFQYTDEHGEVCPAGWKPGGD#TIKPNVEDSKEYF 194 |||||||+||||+ |+||||||| | || +#|||| |++|| || Sbjct 154 VDETLRLIQAFQFVDKHGEVCPANWHPGSE#TIKPGVKESKAYF 196 |
| Debaryomyces hansenii CBS767 | Query 152 VDETLRLVQAFQYTDEHGEVCPAGWKPGGD#TIKPNVEDSKEYFSKNN 198 |+|+||||+|||+|+++|||||| |+|| +#|||| | ||||| | | Sbjct 149 VEESLRLVEAFQFTEKYGEVCPANWQPGSE#TIKPEVSSSKEYFGKVN 195 |
| Pichia guilliermondii ATCC 6260 | Query 152 VDETLRLVQAFQYTDEHGEVCPAGWKPGGD#TIKPNVEDSKEYFSKNN 198 |+|+||||+|||+|+++|||||| |+|| +#|||| |+ +|||| | | Sbjct 149 VEESLRLVEAFQFTEKYGEVCPANWQPGSE#TIKPGVDSAKEYFGKVN 195 |
| Paramecium tetraurelia | Query 152 VDETLRLVQAFQYTDEHGEVCPAGWKPGGD#TIKPNVEDSKEYFSKN 197 |||||||+||||||| ||||||| |||| #|| |+ + |||+|+ Sbjct 183 VDETLRLIQAFQYTDTHGEVCPANWKPGQR#TIVPDQDKKVEYFAKS 228 |
| Toxoptera citricida | Query 152 VDETLRLVQAFQYTDEHGEVCPAGWKPGGD#TIKPNVEDSKEYF 194 ||||||||||||||||||||||| |||| #|| |+ ||+|| Sbjct 149 VDETLRLVQAFQYTDEHGEVCPANWKPGSK#TINPS--KSKDYF 189 |
| Apis mellifera ligustica | Query 152 VDETLRLVQAFQYTDEHGEVCPAGWKPGGD#TIKPNVEDSKEYFSKNN 198 |||||||++|||+ ++||||||| |+| #||||| +|||+|| | Sbjct 196 VDETLRLIKAFQFVEKHGEVCPANWQPDSK#TIKPNPKDSKQYFESVN 242 |
| Trypanosoma cruzi strain CL Brener | Query 152 VDETLRLVQAFQYTDEHGEVCPAGWKPGGD#TIKPNVEDSKEYF 194 ||| ||||+|||+ +|||||||| |||| #|+||+ | ||||| Sbjct 153 VDEALRLVKAFQFVEEHGEVCPANWKPGDK#TMKPDPEKSKEYF 195 |
| Glossina morsitans morsitans | Query 152 VDETLRLVQAFQYTDEHGEVCPAGWKPGGD#TIKPNVEDSKEYFSKNN 198 ||||||| ||||| | |||||||| ||| |#|| | + +||+||| Sbjct 200 VDETLRLXQAFQYXDXHGEVCPAGXKPGAD#TIVLNPREKAKYFAKNN 246 |
| Schistosoma japonicum | Query 152 VDETLRLVQAFQYTDEHGEVCPAGWKPGGD#TIKPNVEDSKEYFSK 196 ||| ||||+|||+||+||||||| |+| | #||||+++ |||| | Sbjct 174 VDEVLRLVRAFQFTDKHGEVCPADWQPKGP#TIKPDLKQYKEYFHK 218 |
| Schistosoma mansoni | Query 152 VDETLRLVQAFQYTDEHGEVCPAGWKPGGD#TIKPNVEDSKEYFSKNN 198 ||| ||||+||||||++|||||| |+| | #||||+++ |||| | | Sbjct 173 VDEVLRLVRAFQYTDKYGEVCPADWQPKGP#TIKPDLKKYKEYFHKVN 219 |
| Pichia stipitis CBS 6054 | Query 152 VDETLRLVQAFQYTDEHGEVCPAGWKPGGD#TIKPNVEDSKEYFSKNN 198 |+|+|||++|||+|+++|||||| | || +#|||| | ||||| | | Sbjct 149 VEESLRLLEAFQFTEKYGEVCPANWTPGAE#TIKPEVSSSKEYFGKVN 195 |
| Candida albicans SC5314 | Query 152 VDETLRLVQAFQYTDEHGEVCPAGWKPGGD#TIKPNVEDSKEYFSKNN 198 |+|+|||++|||+|+++|||||| | || +#||||+ | |||||+| | Sbjct 149 VEESLRLLEAFQFTEKYGEVCPANWHPGDE#TIKPSPEASKEYFNKVN 195 |
| Lodderomyces elongisporus NRRL YB-4239 | Query 152 VDETLRLVQAFQYTDEHGEVCPAGWKPGGD#TIKPNVEDSKEYFSKNN 198 |+|+|||++|||+|+++|||||| |+|| +#||| |||||||| | Sbjct 149 VEESLRLLEAFQFTEKYGEVCPANWQPGSE#TIKATPNDSKEYFSKVN 195 |
| Pongo pygmaeus | Query 152 VDETLRLVQAFQYTDEHGEVCPAGWKPGGD#TIKPNVEDSKEYFSKNN 198 |+||||||+|||| + ||||||| | | #||||| ||||| | | Sbjct 209 VEETLRLVKAFQYVETHGEVCPANWTPDSP#TIKPNPAASKEYFQKVN 255 |
| Amoeba proteus | Query 152 VDETLRLVQAFQYTDEHGEVCPAGWKPGGD#TIKPNVEDSKEYFSK 196 |+| ||+||||+||+||||||| |+|| #||||| | ||||+ Sbjct 128 VEEFKRLIQAFQFTDKHGEVCPASWRPGAA#TIKPNPVDKLEYFSQ 172 |
| Litomosoides sigmodontis | Query 152 VDETLRLVQAFQYTDEHGEVCPAGWKPGGD#TIKPNVEDSK 191 |||||||+||||+ |+|||+||| |+|| +#|||| |++|| Sbjct 154 VDETLRLIQAFQFVDKHGELCPANWQPGSE#TIKPGVKESK 193 |
| Taiwanofungus camphoratus | Query 152 VDETLRLVQAFQYTDEHGEVCPAGWKPGGD#TIKPNVEDSKEYFS 195 ||||+||++|||+|||||||||| | || #||| + + | |||| Sbjct 150 VDETIRLIKAFQFTDEHGEVCPANWTEGGK#TIKADPKGSLEYFS 193 |
| Yarrowia lipolytica | Query 152 VDETLRLVQAFQYTDEHGEVCPAGWKPGGD#TIKPNVEDSKEYFSKNN 198 |+|||||+ |||+|++||||||| |+ | |#||| + ++|||| | | Sbjct 149 VEETLRLIDAFQFTEKHGEVCPANWQKGSD#TIKADPVNAKEYFEKAN 195 |
| Maconellicoccus hirsutus | Query 152 VDETLRLVQAFQYTDEHGEVCPAGWKPGGD#TIKPNVEDSKEYF 194 ||||||||||||+||+||||||| |||| #++| + + ++||| Sbjct 149 VDETLRLVQAFQFTDKHGEVCPANWKPGSK#SMKADPKGAQEYF 191 |
| Trypanosoma cruzi | Query 152 VDETLRLVQAFQYTDEHGEVCPAGWKPGGD#TIKPNVEDSKEYF 194 ||| ||||+|||+ ++||||||| |||| # +||+ | ||||| Sbjct 153 VDEALRLVKAFQFVEKHGEVCPANWKPGDK#AMKPDPEKSKEYF 195 |
| Trypanosoma brucei TREU927 | Query 152 VDETLRLVQAFQYTDEHGEVCPAGWKPGGD#TIKPNVEDSKEYFSKNN 198 ||||||||+|||+ ++||||||| |||| #|+| + |++||| | Sbjct 153 VDETLRLVKAFQFVEKHGEVCPANWKPGSK#TMKADPNGSQDYFSSMN 199 |
| Ostreococcus lucimarinus CCE9901 | Query 152 VDETLRLVQAFQYTDEHGEVCPAGWKPGGD#TIKPNVEDSKEYFSK 196 ||||||||+||||| |||||||||| || #|+ + | || || + Sbjct 148 VDETLRLVRAFQYTAEHGEVCPAGWTPGAP#TMIDDPEKSKTYFEQ 192 |
| Phaeosphaeria nodorum SN15 | Query 152 VDETLRLVQAFQYTDEHGEVCPAGWKPGGD#TIKPNVEDSKEYFSK 196 |||||||+ |||+||++|||||| | || +#||| | +||| | Sbjct 158 VDETLRLIDAFQFTDKYGEVCPANWNPGDE#TIKATPEGNKEYLGK 202 |
| Saccharomyces cerevisiae | Query 152 VDETLRLVQAFQYTDEHGEVCPAGWKPGGD#TIKPNVEDSKEYFSKNN 198 ||| ||||+|||+||++| | | | || #|||| |||||||| | Sbjct 149 VDEALRLVEAFQWTDKNGTVLPCNWTPGAA#TIKPTVEDSKEYFEAAN 195 |
| Gibberella zeae PH-1 | Query 152 VDETLRLVQAFQYTDEHGEVCPAGWKPGGD#TIKPNVEDSKEYFS 195 |+||+|||+|||+|||+||||||||+ || #|+| + + | |||| Sbjct 152 VEETIRLVKAFQFTDEYGEVCPAGWQEGGK#TMKADPKGSLEYFS 195 |
| Ostreococcus tauri | Query 152 VDETLRLVQAFQYTDEHGEVCPAGWKPGGD#TIKPNVEDSKEYF 194 |||||||++| ||| |||||||||| || #|+ + | ||||| Sbjct 6 VDETLRLLRAIQYTKEHGEVCPAGWTPGDP#TMVGDPEKSKEYF 48 |
| Drosophila yakuba | Query 152 VDETLRLVQAFQYTDEHGEVCPAGWKPGGD#TIKPNVEDSKEYF 194 |+|||||||||||||++|||||| |||| #|+ + ||||| Sbjct 148 VEETLRLVQAFQYTDKYGEVCPANWKPGQK#TMVADPTKSKEYF 190 |
| Candida glabrata | Query 152 VDETLRLVQAFQYTDEHGEVCPAGWKPGGD#TIKPNVEDSKEYFSKNN 198 |+|+||||+ ||+||++| | | | || #|||| |||||||| + | Sbjct 149 VEESLRLVEGFQWTDKNGTVLPCNWTPGSA#TIKPTVEDSKEYFKEAN 195 |
| Moniliophthora perniciosa | Query 152 VDETLRLVQAFQYTDEHGEVCPAGWKPGGD#TIKPNVEDSKEYF 194 |+||+|||+|||+||+||||||| | || #||| + + | ||| Sbjct 150 VEETIRLVKAFQFTDKHGEVCPANWSEGGK#TIKADPKSSLEYF 192 |
| Taenia solium | Query 152 VDETLRLVQAFQYTDEHGEVCPAGWKPGGD#TIKPNVEDSKEYFS 195 ||| |||+ |||+||+||||||| |+|| # ||| | | + | Sbjct 152 VDEALRLLDAFQFTDKHGEVCPANWRPGSK#AFKPNAGDLKSFMS 195 |
| Echinococcus granulosus | Query 152 VDETLRLVQAFQYTDEHGEVCPAGWKPGGD#TIKPNVEDSKEYFS 195 ||| |||+ |||+||+||||||| |+|| #| ||+ | | + | Sbjct 149 VDEALRLLDAFQFTDKHGEVCPANWQPGSK#TFKPSAGDLKSFMS 192 |
| Echinococcus multilocularis | Query 152 VDETLRLVQAFQYTDEHGEVCPAGWKPGGD#TIKPNVEDSKEYFS 195 ||| |||+ |||+||+||||||| | || #| ||+ | | + | Sbjct 149 VDEALRLLDAFQFTDKHGEVCPANWHPGSK#TFKPSAGDLKSFMS 192 |
| Tetrahymena thermophila SB210 | Query 152 VDETLRLVQAFQYTDEHGEVCPAGWKPGGD#TIKPNVEDSKEYFS 195 |+|||||++|||+|| ||||||| |+|| #|| |+ + +||| Sbjct 184 VEETLRLIKAFQHTDTHGEVCPANWQPGQK#TIIPDQDQKIKYFS 227 |
| Entamoeba moshkovskii | Query 153 DETLRLVQAFQYTDEHGEVCPAGWKPGGD#TIKPNVEDSKEYFSKN 197 |||+|+|+| |+||+|| ||| |||| |#||+|+ + |+| | + Sbjct 173 DETIRIVKAIQFTDQHGAVCPLNWKPGND#TIEPSHDGIKKYLSSH 217 |
| Phanerochaete chrysosporium | Query 152 VDETLRLVQAFQYTDEHGEVCPAGWKPGGD#TIKPNVEDSKEYFSKNN 198 ||||+||++|||+ +++|||||| || || #|+| + + | |||| | Sbjct 150 VDETIRLIKAFQFVEKYGEVCPANWKEGGK#TMKADPKGSLEYFSTVN 196 |
| Trichomonas vaginalis G3 | Query 152 VDETLRLVQAFQYTDEHGEVCPAGWKPGGD-#TIKPNVEDSKEYFSKNN 198 ||| ||||+|+|+ +||||||| | || #||||| + ||||| | | Sbjct 148 VDEILRLVKAYQFAAKHGEVCPAQWHGEGDL#TIKPNPKASKEYFGKAN 195 |
| Oryza sativa (japonica cultivar-group) | Query 152 VDETLRLVQAFQYTDEH-GEVCPAGWKPGGD#TIKPNVEDSKEYFS 195 |||||| +|| || |+ |||||||||| #++||+ +||||||+ Sbjct 121 VDETLRTLQALQYVQENPDEVCPAGWKPGEK#SMKPDPKDSKEYFA 165 |
| Oryza sativa (indica cultivar-group) | Query 152 VDETLRLVQAFQYTDEH-GEVCPAGWKPGGD#TIKPNVEDSKEYFS 195 |||||| +|| || |+ |||||||||| #++||+ +||||||+ Sbjct 117 VDETLRTLQALQYVQENPDEVCPAGWKPGEK#SMKPDPKDSKEYFA 161 |
| Nitrosococcus oceani ATCC 19707 | Query 152 VDETLRLVQAFQYTDEHGEVCPAGWKPGGD#TIKPNVEDSKEYFSKN 197 |+| ||+| | |+|+||||||||||+ | +# |+|+ | || ||+ Sbjct 150 VEEMLRVVDALQFTEEHGEVCPAGWRKGEE#AIRPDAEGVAEYLSKH 195 |
| Spinacia oleracea | Query 152 VDETLRLVQAFQYTDEHGEVCPAGWKPGGD#TIKPNVEDSKEYFS 195 ||||+| +|| ||| |||||||||| #++||+ + |||||| Sbjct 220 VDETMRTLQALQYTGNPDEVCPAGWKPGEK#SMKPDPKLSKEYFS 263 |
| Kluyveromyces lactis | Query 152 VDETLRLVQAFQYTDEHGEVCPAGWKPGGD#TIKPNVEDSKEYFSKNN 198 |+| ||||+ ||+||++| | | | || #|||| |+ |||||| | Sbjct 149 VEEALRLVEGFQWTDKNGTVLPCNWTPGAA#TIKPEVDASKEYFSSVN 195 |
| Ashbya gossypii ATCC 10895 | Query 152 VDETLRLVQAFQYTDEHGEVCPAGWKPGGD#TIKPNVEDSKEYFSK 196 ||| ||||+ ||+||++| | | | || #||||+| ||||||+ Sbjct 149 VDEALRLVEGFQWTDKNGTVLPCNWTPGAA#TIKPDVAASKEYFSE 193 |
| Brugia malayi | Query 152 VDETLRLVQAFQYTDEHGEVCPAGWKPGGD#TIKPNVEDSKEYFSK 196 ||| | ++|||+ ++||||||| | #|||| +++||||| | Sbjct 180 VDEAFRTLKAFQFVEKHGEVCPANWSDDKP#TIKPGIKESKEYFKK 224 |
| Hordeum vulgare subsp. vulgare | Query 152 VDETLRLVQAFQYTDEHGEVCPAGWKPGGD#TIKPNVEDSKEYFS 195 |||||| +|| || + |||||||||| #++||+ + |||||+ Sbjct 165 VDETLRTLQALQYVKKPDEVCPAGWKPGEK#SMKPDPKGSKEYFA 208 |
| Cryptococcus neoformans var. neoformans JEC21 | Query 152 VDETLRLVQAFQYTDEHGEVCPAGWKPGGD#TIKPNVEDSKEYFSK 196 |+||+|+++|||+||||||||||||+ | |#|| + + |||| Sbjct 154 VEETIRVIKAFQFTDEHGEVCPAGWEEGKD#TIDTSAPSA--YFSK 196 |
| Cryptococcus neoformans var. grubii | Query 152 VDETLRLVQAFQYTDEHGEVCPAGWKPGGD#TIKPNVEDSKEYFSK 196 |+||+|+++|||+||||||||||||+ | |#|| + + |||| Sbjct 154 VEETIRVIKAFQFTDEHGEVCPAGWEEGKD#TIDTSAPSA--YFSK 196 |
| Leptospira borgpetersenii serovar Hardjo-bovis L550 | Query 152 VDETLRLVQAFQYTDEHGEVCPAGWKPGGD#TIKPNVEDSKEYFSKNN 198 +|| +||++|||+ ++||||||| | | #|+| + | ||+||| | Sbjct 147 IDEAIRLIKAFQFVEKHGEVCPANWDEGKK#TMKADPEKSKDYFSAVN 193 |
| Chlorobium ferrooxidans DSM 13031 | Query 152 VDETLRLVQAFQYTDEHGEVCPAGWKPGGD#TIKPNVEDSKEYFSK 196 ||| |||| | |+|+|||||||| | | #|+|| + ||+| + Sbjct 151 VDEVLRLVDALQFTEEHGEVCPANWNKGDK#TMKPTDDGLKEFFKE 195 |
| Prochlorococcus marinus str. NATL2A | Query 152 VDETLRLVQAFQYTDEH-GEVCPAGWKPGGD#TIKPNVEDSKEYFS 195 +|||||++||+|| + | ||||||| || #|+| + + |||||| Sbjct 152 IDETLRVLQAYQYVESHPDEVCPAGWTPGDK#TMKEDPKGSKEYFS 196 |
| Synechococcus sp. BL107 | Query 152 VDETLRLVQAFQYTDEH-GEVCPAGWKPGGD#TIKPNVEDSKEYFS 195 ||||||++||||| + ||||| | || #|+||+ | |||||| Sbjct 153 VDETLRVLQAFQYVQANPDEVCPANWTPGEK#TMKPDPEGSKEYFS 197 |
[Site 2] KPNVEDSKEY193-FSKNN
Tyr193 Phe
|
|||||||||
| P10 | P9 | P8 | P7 | P6 | P5 | P4 | P3 | P2 | P1 |
|---|---|---|---|---|---|---|---|---|---|
| Lys184 | Pro185 | Asn186 | Val187 | Glu188 | Asp189 | Ser190 | Lys191 | Glu192 | Tyr193 |
|
|||||||||
| P1' | P2' | P3' | P4' | P5' | P6' | P7' | P8' | P9' | P10' |
| Phe194 | Ser195 | Lys196 | Asn197 | Asn198 | - | - | - | - | - |
Sequence conservation (by blast) Sequence conservation (by blast)
| Reference peptide (cleaved bond±30 residues) |
|---|
| YTDEHGEVCPAGWKPGGDTIKPNVEDSKEYFSKNN |
Summary
| # | organism | max score | hits | top seq |
|---|---|---|---|---|
| 1 | N/A | 82.80 | 17 | - |
| 2 | Mus musculus | 77.40 | 16 | peroxiredoxin 2 |
| 3 | Homo sapiens | 77.40 | 15 | peroxiredoxin 2 isoform a |
| 4 | Macaca mulatta | 77.40 | 8 | PREDICTED: peroxiredoxin 2 isoform 3 |
| 5 | synthetic construct | 77.40 | 8 | peroxiredoxin 2 |
| 6 | Rattus norvegicus | 77.40 | 7 | peroxiredoxin 2 |
| 7 | Cricetulus griseus | 77.40 | 2 | PRDX2_CRIGR Peroxiredoxin-2 gb |
| 8 | Bos taurus | 75.10 | 5 | peroxiredoxin 2 |
| 9 | Xenopus tropicalis | 69.30 | 4 | peroxiredoxin 2 |
| 10 | Branchiostoma belcheri tsingtaunese | 67.40 | 1 | thioredoxin peroxidase |
| 11 | Canis familiaris | 67.00 | 10 | PREDICTED: similar to peroxiredoxin 1 |
| 12 | Gallus gallus | 67.00 | 6 | PREDICTED: similar to natural killer cell enhancin |
| 13 | Pan troglodytes | 67.00 | 5 | PREDICTED: similar to proliferation associated gen |
| 14 | Macaca fascicularis | 67.00 | 4 | unnamed protein product |
| 15 | Myotis lucifugus | 67.00 | 1 | PRDX1_MYOLU Peroxiredoxin-1 gb |
| 16 | Monodelphis domestica | 66.60 | 3 | PREDICTED: similar to proliferation associated gen |
| 17 | Ciona intestinalis | 66.60 | 1 | peroxiredoxin-like |
| 18 | Spermophilus tridecemlineatus | 66.20 | 1 | peroxiredoxin 2 |
| 19 | Tetraodon nigroviridis | 65.90 | 3 | unnamed protein product |
| 20 | Cyprinus carpio | 65.90 | 1 | natural killer cell enhancing factor |
| 21 | Gekko japonicus | 65.90 | 1 | PRDX1_GECJA Peroxiredoxin-1 gb |
| 22 | Ictalurus punctatus | 65.90 | 1 | natural killer cell enhancing factor |
| 23 | Xenopus laevis | 65.50 | 7 | MGC83078 protein |
| 24 | Danio rerio | 65.50 | 5 | hypothetical protein LOC541344 |
| 25 | Ixodes scapularis | 65.50 | 2 | thioredoxin peroxidase |
| 26 | Oncorhynchus mykiss | 64.30 | 1 | AF250193_1 natural killer cell enhancement factor |
| 27 | Paralichthys olivaceus | 64.30 | 1 | natural killer enhancing factor |
| 28 | Drosophila melanogaster | 63.90 | 3 | thioredoxin peroxidase 2 CG1274-PA, isoform A |
| 29 | Ostertagia ostertagi | 63.90 | 1 | thioredoxin peroxidase |
| 30 | Aedes aegypti | 62.80 | 2 | peroxiredoxins, prx-1, prx-2, prx-3 |
| 31 | Haemonchus contortus | 62.40 | 1 | peroxiredoxin |
| 32 | Drosophila pseudoobscura | 62.00 | 3 | GA11781-PA |
| 33 | Anopheles gambiae str. PEST | 62.00 | 3 | ENSANGP00000010951 |
| 34 | Cynops pyrrhogaster | 62.00 | 1 | TDX_CYNPY Peroxiredoxin (Thioredoxin peroxidase) ( |
| 35 | Scophthalmus maximus | 60.80 | 1 | natural killer enhancing factor |
| 36 | Strongylocentrotus purpuratus | 60.50 | 3 | PREDICTED: similar to thioredoxin peroxidase |
| 37 | Ascaris suum | 59.70 | 1 | PRDX_ASCSU Peroxiredoxin (AsPrx) (Thioredoxin pero |
| 38 | Caenorhabditis elegans | 58.90 | 2 | PeRoxireDoXin family member (prdx-2) |
| 39 | Apis mellifera | 58.90 | 2 | PREDICTED: similar to thioredoxin peroxidase 1 CG1 |
| 40 | Artemia franciscana | 58.90 | 1 | thioredoxin peroxidase |
| 41 | Onchocerca volvulus | 58.50 | 2 | peroxidoxin-2 |
| 42 | Onchocerca ochengi | 58.50 | 1 | peroxidoxin-2 |
| 43 | Caenorhabditis briggsae | 58.20 | 2 | Hypothetical protein CBG02380 |
| 44 | Bombyx mori | 57.80 | 2 | thioredoxin peroxidase |
| 45 | Biomphalaria glabrata | 57.00 | 1 | thioredoxin peroxidase BgTPx |
| 46 | Debaryomyces hansenii CBS767 | 56.60 | 1 | hypothetical protein DEHA0G11154g |
| 47 | Tribolium castaneum | 56.20 | 4 | PREDICTED: similar to Peroxiredoxin-4 (Prx-IV) (Th |
| 48 | Pichia guilliermondii ATCC 6260 | 56.20 | 1 | peroxiredoxin TSA1 |
| 49 | Pichia stipitis CBS 6054 | 55.80 | 1 | Peroxiredoxin TSA1 |
| 50 | Amoeba proteus | 55.50 | 1 | peroxiredoxin |
| 51 | Globodera rostochiensis | 55.10 | 1 | peroxiredoxin |
| 52 | Lodderomyces elongisporus NRRL YB-4239 | 55.10 | 1 | peroxiredoxin TSA1 |
| 53 | Candida albicans SC5314 | 55.10 | 1 | putative thioredoxin peroxidase |
| 54 | Dirofilaria immitis | 54.30 | 2 | thioredoxin peroxidase |
| 55 | Trypanosoma cruzi strain CL Brener | 53.90 | 4 | tryparedoxin peroxidase |
| 56 | Schistosoma japonicum | 53.90 | 1 | SJCHGC01281 protein |
| 57 | Schistosoma mansoni | 53.90 | 1 | AF301001_1 thioredoxin peroxidase 3 |
| 58 | Acanthocheilonema viteae | 53.50 | 1 | thiredoxin peroxidase |
| 59 | Apis mellifera ligustica | 52.80 | 1 | thioredoxin peroxidase |
| 60 | Paramecium tetraurelia | 52.40 | 4 | hypothetical protein |
| 61 | Glossina morsitans morsitans | 52.40 | 3 | putative thioredoxin peroxidase 2 |
| 62 | Pongo pygmaeus | 52.00 | 1 | PRDX3_PONPY Thioredoxin-dependent peroxide reducta |
| 63 | Yarrowia lipolytica | 51.20 | 1 | hypothetical protein |
| 64 | Toxoptera citricida | 51.20 | 1 | putative cytosolic thioredoxin peroxidase |
| 65 | Candida glabrata | 50.40 | 2 | unnamed protein product |
| 66 | Nitrosococcus oceani ATCC 19707 | 50.40 | 1 | Alkyl hydroperoxide reductase/ Thiol specific anti |
| 67 | Trypanosoma cruzi | 50.40 | 1 | AF320771_1 tryparedoxin peroxidase |
| 68 | Ostreococcus tauri | 50.10 | 1 | thioredoxin I (ISS) |
| 69 | Taiwanofungus camphoratus | 50.10 | 1 | peroxiredoxin |
| 70 | Saccharomyces cerevisiae | 49.70 | 1 | Tsa1p |
| 71 | Gibberella zeae PH-1 | 49.70 | 1 | hypothetical protein FG03180.1 |
| 72 | Entamoeba moshkovskii | 48.90 | 3 | peroxiredoxin |
| 73 | Taenia solium | 48.90 | 1 | 2-Cys peroxiredoxin |
| 74 | Phaeosphaeria nodorum SN15 | 48.90 | 1 | hypothetical protein SNOG_00334 |
| 75 | Echinococcus granulosus | 48.50 | 2 | TDX_ECHGR Thioredoxin peroxidase (Peroxiredoxin) ( |
| 76 | Brugia malayi | 48.50 | 1 | TDX1_BRUMA Thioredoxin peroxidase 1 (Peroxiredoxin |
| 77 | Litomosoides sigmodontis | 48.50 | 1 | AF105258_1 peroxidoxin-2 |
| 78 | Fasciola hepatica | 48.10 | 2 | thiol-specific antioxidant protein |
| 79 | Ostreococcus lucimarinus CCE9901 | 48.10 | 1 | predicted protein |
| 80 | Trypanosoma brucei TREU927 | 48.10 | 1 | tryparedoxin peroxidase |
| 81 | Moniliophthora perniciosa | 47.80 | 1 | cys 2 peroxiredoxin |
| 82 | Echinococcus multilocularis | 47.80 | 1 | thioredoxin peroxidase |
| 83 | Maconellicoccus hirsutus | 47.40 | 1 | putative cytosolic thioredoxin peroxidase |
| 84 | Chlamydomonas reinhardtii | 47.00 | 2 | peroxiredoxin |
| 85 | Campylobacter curvus 525.92 | 47.00 | 1 | hypothetical protein Ccur5_02001540 |
| 86 | Kluyveromyces lactis | 47.00 | 1 | unnamed protein product |
| 87 | Spinacia oleracea | 47.00 | 1 | BAS1_SPIOL 2-Cys peroxiredoxin BAS1, chloroplast p |
| 88 | Trichomonas vaginalis G3 | 46.60 | 3 | thioredoxin peroxidase |
| 89 | Oryza sativa (japonica cultivar-group) | 46.60 | 3 | OJ991214_12.15 |
| 90 | Oryza sativa (indica cultivar-group) | 46.60 | 1 | hypothetical protein OsI_015300 |
| 91 | Drosophila yakuba | 46.60 | 1 | similar to Drosophila melanogaster Jafrac1 |
| 92 | Entamoeba histolytica HM-1:IMSS | 46.20 | 7 | peroxiredoxin |
| 93 | Entamoeba histolytica | 46.20 | 3 | 30 kDa type I collagen binding protein |
| 94 | Tetrahymena thermophila SB210 | 45.80 | 1 | AhpC/TSA family protein |
| 95 | Campylobacter jejuni subsp. jejuni NCTC 11168 | 45.80 | 1 | alkyl hydroperoxide reductase |
| 96 | Chlamydomonas incerta | 45.80 | 1 | chloroplast thioredoxin peroxidase |
Top-ranked sequences
| organism | matching |
|---|---|
| N/A | Query 164 YTDEHGEVCPAGWKPGGDTIKPNVEDSKEY#FSKNN 198 ||||||||||||||||||||||||||||||#||||| Query 164 YTDEHGEVCPAGWKPGGDTIKPNVEDSKEY#FSKNN 198 |
| Mus musculus | Query 164 YTDEHGEVCPAGWKPGGDTIKPNVEDSKEY#FSKNN 198 |||||||||||||||| |||||||+|||||#|||+| Sbjct 164 YTDEHGEVCPAGWKPGSDTIKPNVDDSKEY#FSKHN 198 |
| Homo sapiens | Query 164 YTDEHGEVCPAGWKPGGDTIKPNVEDSKEY#FSKNN 198 |||||||||||||||| |||||||+|||||#|||+| Sbjct 164 YTDEHGEVCPAGWKPGSDTIKPNVDDSKEY#FSKHN 198 |
| Macaca mulatta | Query 164 YTDEHGEVCPAGWKPGGDTIKPNVEDSKEY#FSKNN 198 |||||||||||||||| |||||||+|||||#|||+| Sbjct 114 YTDEHGEVCPAGWKPGSDTIKPNVDDSKEY#FSKHN 148 |
| synthetic construct | Query 164 YTDEHGEVCPAGWKPGGDTIKPNVEDSKEY#FSKNN 198 |||||||||||||||| |||||||+|||||#|||+| Sbjct 164 YTDEHGEVCPAGWKPGSDTIKPNVDDSKEY#FSKHN 198 |
| Rattus norvegicus | Query 164 YTDEHGEVCPAGWKPGGDTIKPNVEDSKEY#FSKNN 198 |||||||||||||||| |||||||+|||||#|||+| Sbjct 164 YTDEHGEVCPAGWKPGSDTIKPNVDDSKEY#FSKHN 198 |
| Cricetulus griseus | Query 164 YTDEHGEVCPAGWKPGGDTIKPNVEDSKEY#FSKNN 198 |||||||||||||||| |||||||+|||||#|||+| Sbjct 164 YTDEHGEVCPAGWKPGSDTIKPNVDDSKEY#FSKHN 198 |
| Bos taurus | Query 164 YTDEHGEVCPAGWKPGGDTIKPNVEDSKEY#FSKNN 198 ||||||||||||| || |||||||+|||||#|||+| Sbjct 165 YTDEHGEVCPAGWTPGSDTIKPNVDDSKEY#FSKHN 199 |
| Xenopus tropicalis | Query 164 YTDEHGEVCPAGWKPGGDTIKPNVEDSKEY#FSK 196 |||+|||||||||||| ||||||+||||+#||| Sbjct 172 YTDQHGEVCPAGWKPGSSTIKPNVKDSKEF#FSK 204 |
| Branchiostoma belcheri tsingtaunese | Query 164 YTDEHGEVCPAGWKPGGDTIKPNVEDSKEY#FSK 196 +||+|||||||||||| |||||+|++||||#||| Sbjct 165 FTDKHGEVCPAGWKPGADTIKPDVKNSKEY#FSK 197 |
| Canis familiaris | Query 164 YTDEHGEVCPAGWKPGGDTIKPNVEDSKEY#FSK 196 +||+|||||||||||| |||||+|+ ||||#||| Sbjct 165 FTDKHGEVCPAGWKPGSDTIKPDVQKSKEY#FSK 197 |
| Gallus gallus | Query 164 YTDEHGEVCPAGWKPGGDTIKPNVEDSKEY#FSK 196 +||+|||||||||||| |||||+|+ ||||#||| Sbjct 165 FTDKHGEVCPAGWKPGSDTIKPDVQKSKEY#FSK 197 |
| Pan troglodytes | Query 164 YTDEHGEVCPAGWKPGGDTIKPNVEDSKEY#FSK 196 +||+|||||||||||| |||||+|+ ||||#||| Sbjct 114 FTDKHGEVCPAGWKPGSDTIKPDVQKSKEY#FSK 146 |
| Macaca fascicularis | Query 164 YTDEHGEVCPAGWKPGGDTIKPNVEDSKEY#FSK 196 +||+|||||||||||| |||||+|+ ||||#||| Sbjct 161 FTDKHGEVCPAGWKPGSDTIKPDVQKSKEY#FSK 193 |
| Myotis lucifugus | Query 164 YTDEHGEVCPAGWKPGGDTIKPNVEDSKEY#FSK 196 +||+|||||||||||| |||||+|+ ||||#||| Sbjct 165 FTDKHGEVCPAGWKPGSDTIKPDVQKSKEY#FSK 197 |
| Monodelphis domestica | Query 164 YTDEHGEVCPAGWKPGGDTIKPNVEDSKEY#FSKNN 198 +||++||||||||||| |||||+|+ ||||#||| | Sbjct 165 FTDKYGEVCPAGWKPGSDTIKPDVKGSKEY#FSKQN 199 |
| Ciona intestinalis | Query 164 YTDEHGEVCPAGWKPGGDTIKPNVEDSKEY#FSK 196 +||+|||||||||||| |||||+|+||++|#||| Sbjct 164 FTDQHGEVCPAGWKPGDDTIKPDVQDSQKY#FSK 196 |
| Spermophilus tridecemlineatus | Query 164 YTDEHGEVCPAGWKPGGDTIKPNVEDSKE 192 |||||||||||||||| |||||||+|||| Sbjct 73 YTDEHGEVCPAGWKPGSDTIKPNVDDSKE 101 |
| Tetraodon nigroviridis | Query 164 YTDEHGEVCPAGWKPGGDTIKPNVEDSKEY#FSKN 197 +||+|||||||||||| |||||+|+ |||+#|||+ Sbjct 165 FTDKHGEVCPAGWKPGSDTIKPDVQKSKEF#FSKH 198 |
| Cyprinus carpio | Query 164 YTDEHGEVCPAGWKPGGDTIKPNVEDSKEY#FSKNN 198 +||+|||||||||||| |||||+|+ ||+|#||| + Sbjct 165 FTDKHGEVCPAGWKPGKDTIKPDVQQSKDY#FSKQH 199 |
| Gekko japonicus | Query 164 YTDEHGEVCPAGWKPGGDTIKPNVEDSKEY#FSKN 197 +||+|||||||||+|| |||||+|+ ||||#|||+ Sbjct 165 FTDKHGEVCPAGWQPGSDTIKPDVQKSKEY#FSKH 198 |
| Ictalurus punctatus | Query 164 YTDEHGEVCPAGWKPGGDTIKPNVEDSKEY#FSKNN 198 +||+|||||||||||| |||||+|+ ||++#||| | Sbjct 165 FTDKHGEVCPAGWKPGKDTIKPDVQKSKDF#FSKQN 199 |
| Xenopus laevis | Query 164 YTDEHGEVCPAGWKPGGDTIKPNVEDSKEY#FSK 196 ||| |||||||||||| |||||+||||+#||| Sbjct 168 YTDVHGEVCPAGWKPGSSIIKPNVKDSKEF#FSK 200 |
| Danio rerio | Query 164 YTDEHGEVCPAGWKPGGDTIKPNVEDSKEY#FSKNN 198 +||+|||||||||||| |||||+| ||++#||| | Sbjct 165 FTDKHGEVCPAGWKPGKDTIKPDVNQSKDF#FSKQN 199 |
| Ixodes scapularis | Query 164 YTDEHGEVCPAGWKPGGDTIKPNVEDSKEY#FSK 196 |||+|||||||||||||||| || || +|#||| Sbjct 215 YTDKHGEVCPAGWKPGGDTIIPNPEDKLKY#FSK 247 |
| Oncorhynchus mykiss | Query 164 YTDEHGEVCPAGWKPGGDTIKPNVEDSKEY#FSK 196 +||+|||||||||||| |||||+|+ ||++#||| Sbjct 165 FTDKHGEVCPAGWKPGSDTIKPDVQKSKDF#FSK 197 |
| Paralichthys olivaceus | Query 164 YTDEHGEVCPAGWKPGGDTIKPNVEDSKEY#FSK 196 +||+|||||||||||| |||||+|+ ||++#||| Sbjct 165 FTDKHGEVCPAGWKPGSDTIKPDVQKSKDF#FSK 197 |
| Drosophila melanogaster | Query 164 YTDEHGEVCPAGWKPGGDTIKPNVEDSKEY#FSKNN 198 ||| |||||||||+|| ||| || |+ +|#|+||| Sbjct 208 YTDTHGEVCPAGWRPGADTIVPNPEEKTKY#FAKNN 242 |
| Ostertagia ostertagi | Query 164 YTDEHGEVCPAGWKPGGDTIKPNVEDSKEY#FSKNN 198 | |+||||||||| || |||| |+|||||#||| | Sbjct 159 YVDKHGEVCPAGWTPGKATIKPGVKDSKEY#FSKAN 193 |
| Aedes aegypti | Query 164 YTDEHGEVCPAGWKPGGDTIKPNVEDSKEY#FSKNN 198 |||+|||||||||||| ||| || |+ +|#| ||+ Sbjct 221 YTDKHGEVCPAGWKPGQDTIVPNPEEKMKY#FEKNH 255 |
| Haemonchus contortus | Query 164 YTDEHGEVCPAGWKPGGDTIKPNVEDSKEY#FSKNN 198 | |+||||||||| || +|||| |++|+||#||| | Sbjct 162 YVDKHGEVCPAGWTPGKETIKPRVKESQEY#FSKAN 196 |
| Drosophila pseudoobscura | Query 164 YTDEHGEVCPAGWKPGGDTIKPNVEDSKEY#FSKNN 198 ||| |||||||||+|| ||| |+ |+ +|#|+||| Sbjct 209 YTDTHGEVCPAGWRPGADTIVPDPEEKTKY#FAKNN 243 |
| Anopheles gambiae str. PEST | Query 164 YTDEHGEVCPAGWKPGGDTIKPNVEDSKEY#FSKNN 198 |||+|||||||||||| ||| || |+ +|#| ||+ Sbjct 216 YTDKHGEVCPAGWKPGQDTIVPNPEEKIKY#FEKNH 250 |
| Cynops pyrrhogaster | Query 164 YTDEHGEVCPAGWKPGGDTIKPNVEDSKEY#FSK 196 +||+ ||||||||||| |||||++ ||||#||| Sbjct 165 HTDKFGEVCPAGWKPGSDTIKPDISKSKEY#FSK 197 |
| Scophthalmus maximus | Query 164 YTDEHGEVCPAGWKPGGDTIKPNVEDSKEY#FSK 196 +||+|||||||||||| ||| |+|| || +#||| Sbjct 164 HTDKHGEVCPAGWKPGSDTIIPDVEKSKAF#FSK 196 |
| Strongylocentrotus purpuratus | Query 164 YTDEHGEVCPAGWKPGGDTIKPNVEDSKEY#FSK 196 +||+ ||||||||||| ||||| |++|||+#| | Sbjct 164 FTDKFGEVCPAGWKPGDDTIKPGVKESKEF#FGK 196 |
| Ascaris suum | Query 164 YTDEHGEVCPAGWKPGGDTIKPNVEDSKEY#FSKN 197 + |+||||||||| || ||||| |++|| |#| |+ Sbjct 162 FVDKHGEVCPAGWTPGADTIKPGVKESKAY#FEKH 195 |
| Caenorhabditis elegans | Query 164 YTDEHGEVCPAGWKPGGDTIKPNVEDSKEY#FSKN 197 + ++||||||||| || ||||| |++|+||#| |+ Sbjct 162 FVEKHGEVCPAGWTPGSDTIKPGVKESQEY#FKKH 195 |
| Apis mellifera | Query 164 YTDEHGEVCPAGWKPGGDTIKPNVEDSKEY#F 194 |||+|||||||||||| |+||+| ||||#| Sbjct 161 YTDKHGEVCPAGWKPGKKTMKPDVVGSKEY#F 191 |
| Artemia franciscana | Query 164 YTDEHGEVCPAGWKPGGDTIKPNVEDSKEY#FSKNN 198 |||+|||||||||||| ||| |+ | +|#| | | Sbjct 209 YTDKHGEVCPAGWKPGSDTIVPHPTDKLKY#FGKLN 243 |
| Onchocerca volvulus | Query 164 YTDEHGEVCPAGWKPGGDTIKPNVEDSKEY#FSKN 197 + | ||||||| |+|| +|||| |++||||#| |+ Sbjct 166 FVDNHGEVCPANWQPGSETIKPEVKESKEY#FGKH 199 |
| Onchocerca ochengi | Query 164 YTDEHGEVCPAGWKPGGDTIKPNVEDSKEY#FSKN 197 + | ||||||| |+|| +|||| |++||||#| |+ Sbjct 166 FVDNHGEVCPANWQPGSETIKPEVKESKEY#FGKH 199 |
| Caenorhabditis briggsae | Query 164 YTDEHGEVCPAGWKPGGDTIKPNVEDSKEY#FSKN 197 + ++||||||||| || |||||+|+ |+||#| |+ Sbjct 542 FVEKHGEVCPAGWTPGSDTIKPDVKKSQEY#FGKH 575 |
| Bombyx mori | Query 164 YTDEHGEVCPAGWKP--GGDTIKPNVEDSKEY#FSKNN 198 + |+||||||||| | |||||| +|||||#| | | Sbjct 191 FADKHGEVCPAGWNPDTNADTIKPNPKDSKEY#FQKAN 227 |
| Biomphalaria glabrata | Query 164 YTDEHGEVCPAGWKPGGDTIKPNVEDSKEY#FSKNN 198 |||+|||||||||||| || |+ + ||||#| + + Sbjct 185 YTDKHGEVCPAGWKPGSATIIPDPKKSKEY#FKQQS 219 |
| Debaryomyces hansenii CBS767 | Query 164 YTDEHGEVCPAGWKPGGDTIKPNVEDSKEY#FSKNN 198 +|+++|||||| |+|| +|||| | ||||#| | | Sbjct 161 FTEKYGEVCPANWQPGSETIKPEVSSSKEY#FGKVN 195 |
| Tribolium castaneum | Query 164 YTDEHGEVCPAGWKPGGDTIKPNVEDSKEY#FSKN 197 |||+||||||| |||| ||| || + |+|#| |+ Sbjct 210 YTDKHGEVCPAEWKPGQDTIIPNPIEKKKY#FEKH 243 |
| Pichia guilliermondii ATCC 6260 | Query 164 YTDEHGEVCPAGWKPGGDTIKPNVEDSKEY#FSKNN 198 +|+++|||||| |+|| +|||| |+ +|||#| | | Sbjct 161 FTEKYGEVCPANWQPGSETIKPGVDSAKEY#FGKVN 195 |
| Pichia stipitis CBS 6054 | Query 164 YTDEHGEVCPAGWKPGGDTIKPNVEDSKEY#FSKNN 198 +|+++|||||| | || +|||| | ||||#| | | Sbjct 161 FTEKYGEVCPANWTPGAETIKPEVSSSKEY#FGKVN 195 |
| Amoeba proteus | Query 164 YTDEHGEVCPAGWKPGGDTIKPNVEDSKEY#FSK 196 +||+||||||| |+|| ||||| | ||#||+ Sbjct 140 FTDKHGEVCPASWRPGAATIKPNPVDKLEY#FSQ 172 |
| Globodera rostochiensis | Query 164 YTDEHGEVCPAGWKPGGDTIKPNVEDSKEY#FSK 196 ||| ||||||| |+|| |||||+ | |+ +#| | Sbjct 165 YTDTHGEVCPANWQPGEDTIKPDPEGSQTF#FGK 197 |
| Lodderomyces elongisporus NRRL YB-4239 | Query 164 YTDEHGEVCPAGWKPGGDTIKPNVEDSKEY#FSKNN 198 +|+++|||||| |+|| +||| |||||#||| | Sbjct 161 FTEKYGEVCPANWQPGSETIKATPNDSKEY#FSKVN 195 |
| Candida albicans SC5314 | Query 164 YTDEHGEVCPAGWKPGGDTIKPNVEDSKEY#FSKNN 198 +|+++|||||| | || +||||+ | ||||#|+| | Sbjct 161 FTEKYGEVCPANWHPGDETIKPSPEASKEY#FNKVN 195 |
| Dirofilaria immitis | Query 164 YTDEHGEVCPAGWKPGGDTIKPNVEDSKEY#FSKN 197 + | ||||||| |+|| + ||| |++|| |#| |+ Sbjct 166 FVDNHGEVCPANWQPGSEAIKPGVKESKAY#FEKH 199 |
| Trypanosoma cruzi strain CL Brener | Query 164 YTDEHGEVCPAGWKPGGDTIKPNVEDSKEY#F 194 + +|||||||| |||| |+||+ | ||||#| Sbjct 165 FVEEHGEVCPANWKPGDKTMKPDPEKSKEY#F 195 |
| Schistosoma japonicum | Query 164 YTDEHGEVCPAGWKPGGDTIKPNVEDSKEY#FSK 196 +||+||||||| |+| | ||||+++ |||#| | Sbjct 186 FTDKHGEVCPADWQPKGPTIKPDLKQYKEY#FHK 218 |
| Schistosoma mansoni | Query 164 YTDEHGEVCPAGWKPGGDTIKPNVEDSKEY#FSKNN 198 |||++|||||| |+| | ||||+++ |||#| | | Sbjct 185 YTDKYGEVCPADWQPKGPTIKPDLKKYKEY#FHKVN 219 |
| Acanthocheilonema viteae | Query 164 YTDEHGEVCPAGWKPGGDTIKPNVEDSKEY#F 194 + |+||||||| | || +|||| |++|| |#| Sbjct 166 FVDKHGEVCPANWHPGSETIKPGVKESKAY#F 196 |
| Apis mellifera ligustica | Query 164 YTDEHGEVCPAGWKPGGDTIKPNVEDSKEY#FSKNN 198 + ++||||||| |+| ||||| +|||+|#| | Sbjct 208 FVEKHGEVCPANWQPDSKTIKPNPKDSKQY#FESVN 242 |
| Paramecium tetraurelia | Query 164 YTDEHGEVCPAGWKPGGDTIKPNVEDSKEY#FSKNN 198 | ++||||||| |||| ||||++| || |#+ + Sbjct 164 YVEKHGEVCPASWKPGQATIKPDIEKSKTY#WQNTH 198 |
| Glossina morsitans morsitans | Query 164 YTDEHGEVCPAGWKPGGDTIKPNVEDSKEY#FSKNN 198 | | |||||||| ||| ||| | + +|#|+||| Sbjct 212 YXDXHGEVCPAGXKPGADTIVLNPREKAKY#FAKNN 246 |
| Pongo pygmaeus | Query 164 YTDEHGEVCPAGWKPGGDTIKPNVEDSKEY#FSKNN 198 | + ||||||| | | ||||| ||||#| | | Sbjct 221 YVETHGEVCPANWTPDSPTIKPNPAASKEY#FQKVN 255 |
| Yarrowia lipolytica | Query 164 YTDEHGEVCPAGWKPGGDTIKPNVEDSKEY#FSKNN 198 +|++||||||| |+ | |||| + ++|||#| | | Sbjct 161 FTEKHGEVCPANWQKGSDTIKADPVNAKEY#FEKAN 195 |
| Toxoptera citricida | Query 164 YTDEHGEVCPAGWKPGGDTIKPNVEDSKEY#F 194 ||||||||||| |||| || |+ ||+|#| Sbjct 161 YTDEHGEVCPANWKPGSKTINPS--KSKDY#F 189 |
| Candida glabrata | Query 164 YTDEHGEVCPAGWKPGGDTIKPNVEDSKEY#FSKNN 198 +||++| | | | || |||| |||||||#| + | Sbjct 161 WTDKNGTVLPCNWTPGSATIKPTVEDSKEY#FKEAN 195 |
| Nitrosococcus oceani ATCC 19707 | Query 164 YTDEHGEVCPAGWKPGGDTIKPNVEDSKEY#FSKN 197 +|+||||||||||+ | + |+|+ | ||# ||+ Sbjct 162 FTEEHGEVCPAGWRKGEEAIRPDAEGVAEY#LSKH 195 |
| Trypanosoma cruzi | Query 164 YTDEHGEVCPAGWKPGGDTIKPNVEDSKEY#F 194 + ++||||||| |||| +||+ | ||||#| Sbjct 165 FVEKHGEVCPANWKPGDKAMKPDPEKSKEY#F 195 |
| Ostreococcus tauri | Query 164 YTDEHGEVCPAGWKPGGDTIKPNVEDSKEY#F 194 || |||||||||| || |+ + | ||||#| Sbjct 18 YTKEHGEVCPAGWTPGDPTMVGDPEKSKEY#F 48 |
| Taiwanofungus camphoratus | Query 164 YTDEHGEVCPAGWKPGGDTIKPNVEDSKEY#FS 195 +|||||||||| | || ||| + + | ||#|| Sbjct 162 FTDEHGEVCPANWTEGGKTIKADPKGSLEY#FS 193 |
| Saccharomyces cerevisiae | Query 164 YTDEHGEVCPAGWKPGGDTIKPNVEDSKEY#FSKNN 198 +||++| | | | || |||| |||||||#| | Sbjct 161 WTDKNGTVLPCNWTPGAATIKPTVEDSKEY#FEAAN 195 |
| Gibberella zeae PH-1 | Query 164 YTDEHGEVCPAGWKPGGDTIKPNVEDSKEY#FS 195 +|||+||||||||+ || |+| + + | ||#|| Sbjct 164 FTDEYGEVCPAGWQEGGKTMKADPKGSLEY#FS 195 |
| Entamoeba moshkovskii | Query 164 YTDEHGEVCPAGWKPGGDTIKPNVEDSKEY#FSKN 197 +||+|| ||| |||| |||+|+ + |+|# | + Sbjct 184 FTDQHGAVCPLNWKPGNDTIEPSHDGIKKY#LSSH 217 |
| Taenia solium | Query 164 YTDEHGEVCPAGWKPGGDTIKPNVEDSKEY#FS 195 +||+||||||| |+|| ||| | | +# | Sbjct 164 FTDKHGEVCPANWRPGSKAFKPNAGDLKSF#MS 195 |
| Phaeosphaeria nodorum SN15 | Query 164 YTDEHGEVCPAGWKPGGDTIKPNVEDSKEY#FSK 196 +||++|||||| | || +||| | +|||# | Sbjct 170 FTDKYGEVCPANWNPGDETIKATPEGNKEY#LGK 202 |
| Echinococcus granulosus | Query 164 YTDEHGEVCPAGWKPGGDTIKPNVEDSKEY#FS 195 +||+||||||| |+|| | ||+ | | +# | Sbjct 161 FTDKHGEVCPANWQPGSKTFKPSAGDLKSF#MS 192 |
| Brugia malayi | Query 164 YTDEHGEVCPAGWKPGGDTIKPNVEDSKEY#FSK 196 + ++||||||| | |||| +++||||#| | Sbjct 192 FVEKHGEVCPANWSDDKPTIKPGIKESKEY#FKK 224 |
| Litomosoides sigmodontis | Query 164 YTDEHGEVCPAGWKPGGDTIKPNVEDSK 191 + |+|||+||| |+|| +|||| |++|| Sbjct 166 FVDKHGELCPANWQPGSETIKPGVKESK 193 |
| Fasciola hepatica | Query 164 YTDEHGEVCPAGWKPGGDTIKPNVEDSKEY#FSKNN 198 + +|||||||| ||| || | + || |#|| | Sbjct 160 FHEEHGEVCPANWKPKSKTIVPTPDGSKAY#FSSAN 194 |
| Ostreococcus lucimarinus CCE9901 | Query 164 YTDEHGEVCPAGWKPGGDTIKPNVEDSKEY#FSK 196 || |||||||||| || |+ + | || |#| + Sbjct 160 YTAEHGEVCPAGWTPGAPTMIDDPEKSKTY#FEQ 192 |
| Trypanosoma brucei TREU927 | Query 164 YTDEHGEVCPAGWKPGGDTIKPNVEDSKEY#FSKNN 198 + ++||||||| |||| |+| + |++|#|| | Sbjct 165 FVEKHGEVCPANWKPGSKTMKADPNGSQDY#FSSMN 199 |
| Moniliophthora perniciosa | Query 164 YTDEHGEVCPAGWKPGGDTIKPNVEDSKEY#F 194 +||+||||||| | || ||| + + | ||#| Sbjct 162 FTDKHGEVCPANWSEGGKTIKADPKSSLEY#F 192 |
| Echinococcus multilocularis | Query 164 YTDEHGEVCPAGWKPGGDTIKPNVEDSKEY#FS 195 +||+||||||| | || | ||+ | | +# | Sbjct 161 FTDKHGEVCPANWHPGSKTFKPSAGDLKSF#MS 192 |
| Maconellicoccus hirsutus | Query 164 YTDEHGEVCPAGWKPGGDTIKPNVEDSKEY#F 194 +||+||||||| |||| ++| + + ++||#| Sbjct 161 FTDKHGEVCPANWKPGSKSMKADPKGAQEY#F 191 |
| Chlamydomonas reinhardtii | Query 170 EVCPAGWKPGGDTIKPNVEDSKEY#FS 195 |||||||||| |+||+ + ||||#|| Sbjct 172 EVCPAGWKPGDKTMKPDPKGSKEY#FS 197 |
| Campylobacter curvus 525.92 | Query 164 YTDEHGEVCPAGWKPGGDTIKPNVEDSKEY#FSKN 197 +|+|||||||||| | + +||+ | +|# | | Sbjct 162 FTNEHGEVCPAGWHKGDEGMKPSTEGVADY#LSHN 195 |
| Kluyveromyces lactis | Query 164 YTDEHGEVCPAGWKPGGDTIKPNVEDSKEY#FSKNN 198 +||++| | | | || |||| |+ ||||#|| | Sbjct 161 WTDKNGTVLPCNWTPGAATIKPEVDASKEY#FSSVN 195 |
| Spinacia oleracea | Query 164 YTDEHGEVCPAGWKPGGDTIKPNVEDSKEY#FS 195 || |||||||||| ++||+ + ||||#|| Sbjct 232 YTGNPDEVCPAGWKPGEKSMKPDPKLSKEY#FS 263 |
| Trichomonas vaginalis G3 | Query 164 YTDEHGEVCPAGWKPGGD-TIKPNVEDSKEY#FSKNN 198 + +||||||| | || ||||| + ||||#| | | Sbjct 160 FAAKHGEVCPAQWHGEGDLTIKPNPKASKEY#FGKAN 195 |
| Oryza sativa (japonica cultivar-group) | Query 170 EVCPAGWKPGGDTIKPNVEDSKEY#FS 195 |||||||||| ++||+ +|||||#|+ Sbjct 140 EVCPAGWKPGEKSMKPDPKDSKEY#FA 165 |
| Oryza sativa (indica cultivar-group) | Query 170 EVCPAGWKPGGDTIKPNVEDSKEY#FS 195 |||||||||| ++||+ +|||||#|+ Sbjct 136 EVCPAGWKPGEKSMKPDPKDSKEY#FA 161 |
| Drosophila yakuba | Query 164 YTDEHGEVCPAGWKPGGDTIKPNVEDSKEY#F 194 |||++|||||| |||| |+ + ||||#| Sbjct 160 YTDKYGEVCPANWKPGQKTMVADPTKSKEY#F 190 |
| Entamoeba histolytica HM-1:IMSS | Query 164 YTDEHGEVCPAGWKPGGDTIKPNVEDSKEY#FS 195 ++|||| ||| |||| |||+| + |+|# + Sbjct 196 FSDEHGAVCPLNWKPGKDTIEPTPDGIKKY#LT 227 |
| Entamoeba histolytica | Query 164 YTDEHGEVCPAGWKPGGDTIKPNVEDSKEY#FS 195 ++|||| ||| |||| |||+| + |+|# + Sbjct 176 FSDEHGAVCPLNWKPGKDTIEPTSDGIKKY#LT 207 |
| Tetrahymena thermophila SB210 | Query 164 YTDEHGEVCPAGWKPGGDTIKPN--VEDSKEY#FSK 196 +|||||||||| |+||| + || | ||+#+ | Sbjct 187 FTDEHGEVCPAKWRPGGKGMVPNHQSEKLKEF#WEK 221 |
| Campylobacter jejuni subsp. jejuni NCTC 11168 | Query 164 YTDEHGEVCPAGWKPGGDTIKPNVEDSKEY#FSKN 197 +|+|||||||||| | + +| | + ||# || Sbjct 161 FTNEHGEVCPAGWNKGDEGMKANPKGVAEY#LGKN 194 |
| Chlamydomonas incerta | Query 170 EVCPAGWKPGGDTIKPNVEDSKEY#FS 195 |||||||||| |+||+ + ||||#|+ Sbjct 208 EVCPAGWKPGDKTMKPDPKGSKEY#FA 233 |
[Site 3] AGWKPGGDTI183-KPNVEDSKEY
Ile183 Lys
|
|||||||||
| P10 | P9 | P8 | P7 | P6 | P5 | P4 | P3 | P2 | P1 |
|---|---|---|---|---|---|---|---|---|---|
| Ala174 | Gly175 | Trp176 | Lys177 | Pro178 | Gly179 | Gly180 | Asp181 | Thr182 | Ile183 |
|
|||||||||
| P1' | P2' | P3' | P4' | P5' | P6' | P7' | P8' | P9' | P10' |
| Lys184 | Pro185 | Asn186 | Val187 | Glu188 | Asp189 | Ser190 | Lys191 | Glu192 | Tyr193 |
Sequence conservation (by blast) Sequence conservation (by blast)
| Reference peptide (cleaved bond±30 residues) |
|---|
| ETLRLVQAFQYTDEHGEVCPAGWKPGGDTIKPNVEDSKEYFSKNN |
Summary
| # | organism | max score | hits | top seq |
|---|---|---|---|---|
| 1 | N/A | 100.00 | 18 | - |
| 2 | Mus musculus | 93.60 | 16 | PRDX2_MOUSE Peroxiredoxin-2 (Thioredoxin peroxidas |
| 3 | Homo sapiens | 93.60 | 15 | peroxiredoxin 2 isoform a |
| 4 | Macaca mulatta | 93.60 | 8 | PREDICTED: peroxiredoxin 2 isoform 3 |
| 5 | synthetic construct | 93.60 | 8 | peroxiredoxin 2 |
| 6 | Rattus norvegicus | 93.60 | 7 | peroxiredoxin 2 |
| 7 | Cricetulus griseus | 93.60 | 2 | PRDX2_CRIGR Peroxiredoxin-2 gb |
| 8 | Bos taurus | 91.30 | 5 | peroxiredoxin 2 |
| 9 | Xenopus tropicalis | 87.40 | 4 | peroxiredoxin 2 |
| 10 | Branchiostoma belcheri tsingtaunese | 85.50 | 1 | thioredoxin peroxidase |
| 11 | Canis familiaris | 85.10 | 9 | PREDICTED: similar to peroxiredoxin 1 |
| 12 | Gallus gallus | 85.10 | 6 | PREDICTED: similar to natural killer cell enhancin |
| 13 | Pan troglodytes | 85.10 | 6 | PREDICTED: similar to proliferation associated gen |
| 14 | Macaca fascicularis | 85.10 | 4 | unnamed protein product |
| 15 | Myotis lucifugus | 85.10 | 1 | PRDX1_MYOLU Peroxiredoxin-1 gb |
| 16 | Monodelphis domestica | 84.30 | 3 | PREDICTED: similar to proliferation associated gen |
| 17 | Tetraodon nigroviridis | 84.00 | 3 | unnamed protein product |
| 18 | Ictalurus punctatus | 84.00 | 1 | natural killer cell enhancing factor |
| 19 | Cyprinus carpio | 84.00 | 1 | natural killer cell enhancing factor |
| 20 | Gekko japonicus | 84.00 | 1 | PRDX1_GECJA Peroxiredoxin-1 gb |
| 21 | Xenopus laevis | 83.60 | 7 | MGC83078 protein |
| 22 | Danio rerio | 83.60 | 5 | hypothetical protein LOC541344 |
| 23 | Ixodes scapularis | 83.60 | 3 | thioredoxin peroxidase |
| 24 | Ciona intestinalis | 83.20 | 1 | peroxiredoxin-like |
| 25 | Spermophilus tridecemlineatus | 82.40 | 1 | peroxiredoxin 2 |
| 26 | Paralichthys olivaceus | 82.40 | 1 | natural killer enhancing factor |
| 27 | Oncorhynchus mykiss | 82.40 | 1 | AF250193_1 natural killer cell enhancement factor |
| 28 | Ostertagia ostertagi | 82.00 | 1 | thioredoxin peroxidase |
| 29 | Drosophila melanogaster | 81.30 | 3 | thioredoxin peroxidase 2 CG1274-PA, isoform A |
| 30 | Aedes aegypti | 80.90 | 3 | peroxiredoxins, prx-1, prx-2, prx-3 |
| 31 | Haemonchus contortus | 80.50 | 1 | peroxiredoxin |
| 32 | Anopheles gambiae str. PEST | 80.10 | 3 | ENSANGP00000010951 |
| 33 | Cynops pyrrhogaster | 80.10 | 1 | TDX_CYNPY Peroxiredoxin (Thioredoxin peroxidase) ( |
| 34 | Drosophila pseudoobscura | 79.30 | 3 | GA11781-PA |
| 35 | Ascaris suum | 77.80 | 1 | PRDX_ASCSU Peroxiredoxin (AsPrx) (Thioredoxin pero |
| 36 | Caenorhabditis elegans | 77.00 | 2 | PeRoxireDoXin family member (prdx-2) |
| 37 | Apis mellifera | 77.00 | 2 | PREDICTED: similar to thioredoxin peroxidase 1 CG1 |
| 38 | Scophthalmus maximus | 77.00 | 1 | natural killer enhancing factor |
| 39 | Artemia franciscana | 77.00 | 1 | thioredoxin peroxidase |
| 40 | Strongylocentrotus purpuratus | 76.60 | 3 | PREDICTED: similar to thioredoxin peroxidase |
| 41 | Onchocerca volvulus | 76.60 | 2 | peroxidoxin-2 |
| 42 | Caenorhabditis briggsae | 76.30 | 2 | Hypothetical protein CBG02380 |
| 43 | Onchocerca ochengi | 76.30 | 1 | peroxidoxin-2 |
| 44 | Biomphalaria glabrata | 75.10 | 1 | thioredoxin peroxidase BgTPx |
| 45 | Tribolium castaneum | 74.30 | 4 | PREDICTED: similar to Peroxiredoxin-4 (Prx-IV) (Th |
| 46 | Bombyx mori | 74.30 | 2 | thioredoxin peroxidase |
| 47 | Dirofilaria immitis | 72.00 | 2 | thioredoxin peroxidase |
| 48 | Debaryomyces hansenii CBS767 | 72.00 | 1 | hypothetical protein DEHA0G11154g |
| 49 | Pichia guilliermondii ATCC 6260 | 71.60 | 1 | peroxiredoxin TSA1 |
| 50 | Globodera rostochiensis | 71.60 | 1 | peroxiredoxin |
| 51 | Acanthocheilonema viteae | 71.20 | 1 | thiredoxin peroxidase |
| 52 | Pichia stipitis CBS 6054 | 70.10 | 1 | Peroxiredoxin TSA1 |
| 53 | Paramecium tetraurelia | 69.70 | 8 | hypothetical protein |
| 54 | Toxoptera citricida | 69.30 | 1 | putative cytosolic thioredoxin peroxidase |
| 55 | Candida albicans SC5314 | 69.30 | 1 | putative thioredoxin peroxidase |
| 56 | Lodderomyces elongisporus NRRL YB-4239 | 69.30 | 1 | peroxiredoxin TSA1 |
| 57 | Apis mellifera ligustica | 68.90 | 1 | thioredoxin peroxidase |
| 58 | Trypanosoma cruzi strain CL Brener | 68.60 | 4 | tryparedoxin peroxidase |
| 59 | Glossina morsitans morsitans | 68.60 | 3 | putative thioredoxin peroxidase 2 |
| 60 | Schistosoma mansoni | 68.60 | 1 | AF301001_1 thioredoxin peroxidase 3 |
| 61 | Schistosoma japonicum | 68.60 | 1 | SJCHGC01281 protein |
| 62 | Pongo pygmaeus | 68.60 | 1 | PRDX3_PONPY Thioredoxin-dependent peroxide reducta |
| 63 | Amoeba proteus | 68.20 | 1 | peroxiredoxin |
| 64 | Yarrowia lipolytica | 67.00 | 1 | hypothetical protein |
| 65 | Litomosoides sigmodontis | 66.20 | 1 | AF105258_1 peroxidoxin-2 |
| 66 | Maconellicoccus hirsutus | 65.50 | 1 | putative cytosolic thioredoxin peroxidase |
| 67 | Taiwanofungus camphoratus | 65.50 | 1 | peroxiredoxin |
| 68 | Gibberella zeae PH-1 | 65.50 | 1 | hypothetical protein FG03180.1 |
| 69 | Trypanosoma cruzi | 65.10 | 1 | AF320771_1 tryparedoxin peroxidase |
| 70 | Trypanosoma brucei TREU927 | 64.70 | 1 | tryparedoxin peroxidase |
| 71 | Phaeosphaeria nodorum SN15 | 64.70 | 1 | hypothetical protein SNOG_00334 |
| 72 | Ostreococcus lucimarinus CCE9901 | 64.70 | 1 | predicted protein |
| 73 | Drosophila yakuba | 64.70 | 1 | similar to Drosophila melanogaster Jafrac1 |
| 74 | Saccharomyces cerevisiae | 64.70 | 1 | Tsa1p |
| 75 | Candida glabrata | 64.30 | 2 | unnamed protein product |
| 76 | Moniliophthora perniciosa | 63.50 | 1 | cys 2 peroxiredoxin |
| 77 | Ostreococcus tauri | 63.20 | 1 | thioredoxin I (ISS) |
| 78 | Taenia solium | 62.00 | 1 | 2-Cys peroxiredoxin |
| 79 | Tetrahymena thermophila SB210 | 61.60 | 3 | AhpC/TSA family protein |
| 80 | Entamoeba moshkovskii | 61.60 | 3 | peroxiredoxin |
| 81 | Echinococcus granulosus | 61.60 | 2 | TDX_ECHGR Thioredoxin peroxidase (Peroxiredoxin) ( |
| 82 | Echinococcus multilocularis | 60.80 | 1 | thioredoxin peroxidase |
| 83 | Nitrosococcus oceani ATCC 19707 | 60.80 | 1 | Alkyl hydroperoxide reductase/ Thiol specific anti |
| 84 | Kluyveromyces lactis | 60.50 | 1 | unnamed protein product |
| 85 | Phanerochaete chrysosporium | 60.10 | 1 | peroxiredoxins |
| 86 | Trichomonas vaginalis G3 | 59.70 | 3 | thioredoxin peroxidase |
| 87 | Cryptococcus neoformans var. neoformans JEC21 | 59.70 | 1 | thioredoxin-dependent peroxide reductase |
| 88 | Cryptococcus neoformans var. grubii | 59.70 | 1 | thiol-specific antioxidant protein 1 |
| 89 | Oryza sativa (japonica cultivar-group) | 59.30 | 2 | OJ991214_12.15 |
| 90 | Oryza sativa (indica cultivar-group) | 59.30 | 1 | hypothetical protein OsI_015300 |
| 91 | Entamoeba histolytica HM-1:IMSS | 58.90 | 3 | peroxiredoxin |
| 92 | Entamoeba histolytica | 58.90 | 3 | 30 kDa type I collagen binding protein |
| 93 | Spinacia oleracea | 58.90 | 1 | BAS1_SPIOL 2-Cys peroxiredoxin BAS1, chloroplast p |
| 94 | Ashbya gossypii ATCC 10895 | 58.90 | 1 | AER312Wp |
Top-ranked sequences
| organism | matching |
|---|---|
| N/A | Query 154 ETLRLVQAFQYTDEHGEVCPAGWKPGGDTI#KPNVEDSKEYFSKNN 198 ||||||||||||||||||||||||||||||#||||||||||||||| Query 154 ETLRLVQAFQYTDEHGEVCPAGWKPGGDTI#KPNVEDSKEYFSKNN 198 |
| Mus musculus | Query 154 ETLRLVQAFQYTDEHGEVCPAGWKPGGDTI#KPNVEDSKEYFSKNN 198 | |||||||||||||||||||||||| |||#||||+||||||||+| Sbjct 154 EALRLVQAFQYTDEHGEVCPAGWKPGSDTI#KPNVDDSKEYFSKHN 198 |
| Homo sapiens | Query 154 ETLRLVQAFQYTDEHGEVCPAGWKPGGDTI#KPNVEDSKEYFSKNN 198 | |||||||||||||||||||||||| |||#||||+||||||||+| Sbjct 154 EALRLVQAFQYTDEHGEVCPAGWKPGSDTI#KPNVDDSKEYFSKHN 198 |
| Macaca mulatta | Query 154 ETLRLVQAFQYTDEHGEVCPAGWKPGGDTI#KPNVEDSKEYFSKNN 198 | |||||||||||||||||||||||| |||#||||+||||||||+| Sbjct 104 EALRLVQAFQYTDEHGEVCPAGWKPGSDTI#KPNVDDSKEYFSKHN 148 |
| synthetic construct | Query 154 ETLRLVQAFQYTDEHGEVCPAGWKPGGDTI#KPNVEDSKEYFSKNN 198 | |||||||||||||||||||||||| |||#||||+||||||||+| Sbjct 154 EALRLVQAFQYTDEHGEVCPAGWKPGSDTI#KPNVDDSKEYFSKHN 198 |
| Rattus norvegicus | Query 154 ETLRLVQAFQYTDEHGEVCPAGWKPGGDTI#KPNVEDSKEYFSKNN 198 | |||||||||||||||||||||||| |||#||||+||||||||+| Sbjct 154 EALRLVQAFQYTDEHGEVCPAGWKPGSDTI#KPNVDDSKEYFSKHN 198 |
| Cricetulus griseus | Query 154 ETLRLVQAFQYTDEHGEVCPAGWKPGGDTI#KPNVEDSKEYFSKNN 198 | |||||||||||||||||||||||| |||#||||+||||||||+| Sbjct 154 EALRLVQAFQYTDEHGEVCPAGWKPGSDTI#KPNVDDSKEYFSKHN 198 |
| Bos taurus | Query 154 ETLRLVQAFQYTDEHGEVCPAGWKPGGDTI#KPNVEDSKEYFSKNN 198 | ||||||||||||||||||||| || |||#||||+||||||||+| Sbjct 155 EALRLVQAFQYTDEHGEVCPAGWTPGSDTI#KPNVDDSKEYFSKHN 199 |
| Xenopus tropicalis | Query 154 ETLRLVQAFQYTDEHGEVCPAGWKPGGDTI#KPNVEDSKEYFSK 196 |||||||||||||+|||||||||||| ||#||||+||||+||| Sbjct 162 ETLRLVQAFQYTDQHGEVCPAGWKPGSSTI#KPNVKDSKEFFSK 204 |
| Branchiostoma belcheri tsingtaunese | Query 154 ETLRLVQAFQYTDEHGEVCPAGWKPGGDTI#KPNVEDSKEYFSK 196 ||||||||||+||+|||||||||||| |||#||+|++||||||| Sbjct 155 ETLRLVQAFQFTDKHGEVCPAGWKPGADTI#KPDVKNSKEYFSK 197 |
| Canis familiaris | Query 154 ETLRLVQAFQYTDEHGEVCPAGWKPGGDTI#KPNVEDSKEYFSK 196 ||||||||||+||+|||||||||||| |||#||+|+ ||||||| Sbjct 155 ETLRLVQAFQFTDKHGEVCPAGWKPGSDTI#KPDVQKSKEYFSK 197 |
| Gallus gallus | Query 154 ETLRLVQAFQYTDEHGEVCPAGWKPGGDTI#KPNVEDSKEYFSK 196 ||||||||||+||+|||||||||||| |||#||+|+ ||||||| Sbjct 155 ETLRLVQAFQFTDKHGEVCPAGWKPGSDTI#KPDVQKSKEYFSK 197 |
| Pan troglodytes | Query 154 ETLRLVQAFQYTDEHGEVCPAGWKPGGDTI#KPNVEDSKEYFSK 196 ||||||||||+||+|||||||||||| |||#||+|+ ||||||| Sbjct 104 ETLRLVQAFQFTDKHGEVCPAGWKPGSDTI#KPDVQKSKEYFSK 146 |
| Macaca fascicularis | Query 154 ETLRLVQAFQYTDEHGEVCPAGWKPGGDTI#KPNVEDSKEYFSK 196 ||||||||||+||+|||||||||||| |||#||+|+ ||||||| Sbjct 151 ETLRLVQAFQFTDKHGEVCPAGWKPGSDTI#KPDVQKSKEYFSK 193 |
| Myotis lucifugus | Query 154 ETLRLVQAFQYTDEHGEVCPAGWKPGGDTI#KPNVEDSKEYFSK 196 ||||||||||+||+|||||||||||| |||#||+|+ ||||||| Sbjct 155 ETLRLVQAFQFTDKHGEVCPAGWKPGSDTI#KPDVQKSKEYFSK 197 |
| Monodelphis domestica | Query 154 ETLRLVQAFQYTDEHGEVCPAGWKPGGDTI#KPNVEDSKEYFSKNN 198 |||||+||||+||++||||||||||| |||#||+|+ ||||||| | Sbjct 155 ETLRLIQAFQFTDKYGEVCPAGWKPGSDTI#KPDVKGSKEYFSKQN 199 |
| Tetraodon nigroviridis | Query 154 ETLRLVQAFQYTDEHGEVCPAGWKPGGDTI#KPNVEDSKEYFSKN 197 ||||||||||+||+|||||||||||| |||#||+|+ |||+|||+ Sbjct 155 ETLRLVQAFQFTDKHGEVCPAGWKPGSDTI#KPDVQKSKEFFSKH 198 |
| Ictalurus punctatus | Query 154 ETLRLVQAFQYTDEHGEVCPAGWKPGGDTI#KPNVEDSKEYFSKNN 198 ||||||||||+||+|||||||||||| |||#||+|+ ||++||| | Sbjct 155 ETLRLVQAFQFTDKHGEVCPAGWKPGKDTI#KPDVQKSKDFFSKQN 199 |
| Cyprinus carpio | Query 154 ETLRLVQAFQYTDEHGEVCPAGWKPGGDTI#KPNVEDSKEYFSKNN 198 ||||||||||+||+|||||||||||| |||#||+|+ ||+|||| + Sbjct 155 ETLRLVQAFQFTDKHGEVCPAGWKPGKDTI#KPDVQQSKDYFSKQH 199 |
| Gekko japonicus | Query 154 ETLRLVQAFQYTDEHGEVCPAGWKPGGDTI#KPNVEDSKEYFSKN 197 ||||||||||+||+|||||||||+|| |||#||+|+ |||||||+ Sbjct 155 ETLRLVQAFQFTDKHGEVCPAGWQPGSDTI#KPDVQKSKEYFSKH 198 |
| Xenopus laevis | Query 154 ETLRLVQAFQYTDEHGEVCPAGWKPGGDTI#KPNVEDSKEYFSK 196 ||||||||||||| |||||||||||| |#||||+||||+||| Sbjct 158 ETLRLVQAFQYTDVHGEVCPAGWKPGSSII#KPNVKDSKEFFSK 200 |
| Danio rerio | Query 154 ETLRLVQAFQYTDEHGEVCPAGWKPGGDTI#KPNVEDSKEYFSKNN 198 ||||||||||+||+|||||||||||| |||#||+| ||++||| | Sbjct 155 ETLRLVQAFQFTDKHGEVCPAGWKPGKDTI#KPDVNQSKDFFSKQN 199 |
| Ixodes scapularis | Query 154 ETLRLVQAFQYTDEHGEVCPAGWKPGGDTI#KPNVEDSKEYFSK 196 |||||||||||||+||||||||||||||||# || || +|||| Sbjct 205 ETLRLVQAFQYTDKHGEVCPAGWKPGGDTI#IPNPEDKLKYFSK 247 |
| Ciona intestinalis | Query 154 ETLRLVQAFQYTDEHGEVCPAGWKPGGDTI#KPNVEDSKEYFSK 196 ||||||+|||+||+|||||||||||| |||#||+|+||++|||| Sbjct 154 ETLRLVKAFQFTDQHGEVCPAGWKPGDDTI#KPDVQDSQKYFSK 196 |
| Spermophilus tridecemlineatus | Query 154 ETLRLVQAFQYTDEHGEVCPAGWKPGGDTI#KPNVEDSKE 192 | |||||||||||||||||||||||| |||#||||+|||| Sbjct 63 EALRLVQAFQYTDEHGEVCPAGWKPGSDTI#KPNVDDSKE 101 |
| Paralichthys olivaceus | Query 154 ETLRLVQAFQYTDEHGEVCPAGWKPGGDTI#KPNVEDSKEYFSK 196 ||||||||||+||+|||||||||||| |||#||+|+ ||++||| Sbjct 155 ETLRLVQAFQFTDKHGEVCPAGWKPGSDTI#KPDVQKSKDFFSK 197 |
| Oncorhynchus mykiss | Query 154 ETLRLVQAFQYTDEHGEVCPAGWKPGGDTI#KPNVEDSKEYFSK 196 ||||||||||+||+|||||||||||| |||#||+|+ ||++||| Sbjct 155 ETLRLVQAFQFTDKHGEVCPAGWKPGSDTI#KPDVQKSKDFFSK 197 |
| Ostertagia ostertagi | Query 154 ETLRLVQAFQYTDEHGEVCPAGWKPGGDTI#KPNVEDSKEYFSKNN 198 ||||||||||| |+||||||||| || ||#|| |+|||||||| | Sbjct 149 ETLRLVQAFQYVDKHGEVCPAGWTPGKATI#KPGVKDSKEYFSKAN 193 |
| Drosophila melanogaster | Query 154 ETLRLVQAFQYTDEHGEVCPAGWKPGGDTI#KPNVEDSKEYFSKNN 198 ||+|||||||||| |||||||||+|| |||# || |+ +||+||| Sbjct 198 ETIRLVQAFQYTDTHGEVCPAGWRPGADTI#VPNPEEKTKYFAKNN 242 |
| Aedes aegypti | Query 154 ETLRLVQAFQYTDEHGEVCPAGWKPGGDTI#KPNVEDSKEYFSKNN 198 |||||||||||||+|||||||||||| |||# || |+ +|| ||+ Sbjct 211 ETLRLVQAFQYTDKHGEVCPAGWKPGQDTI#VPNPEEKMKYFEKNH 255 |
| Haemonchus contortus | Query 154 ETLRLVQAFQYTDEHGEVCPAGWKPGGDTI#KPNVEDSKEYFSKNN 198 ||||||||||| |+||||||||| || +||#|| |++|+||||| | Sbjct 152 ETLRLVQAFQYVDKHGEVCPAGWTPGKETI#KPRVKESQEYFSKAN 196 |
| Anopheles gambiae str. PEST | Query 154 ETLRLVQAFQYTDEHGEVCPAGWKPGGDTI#KPNVEDSKEYFSKNN 198 |||||||||||||+|||||||||||| |||# || |+ +|| ||+ Sbjct 206 ETLRLVQAFQYTDKHGEVCPAGWKPGQDTI#VPNPEEKIKYFEKNH 250 |
| Cynops pyrrhogaster | Query 154 ETLRLVQAFQYTDEHGEVCPAGWKPGGDTI#KPNVEDSKEYFSK 196 ||||||||||+||+ ||||||||||| |||#||++ ||||||| Sbjct 155 ETLRLVQAFQHTDKFGEVCPAGWKPGSDTI#KPDISKSKEYFSK 197 |
| Drosophila pseudoobscura | Query 154 ETLRLVQAFQYTDEHGEVCPAGWKPGGDTI#KPNVEDSKEYFSKNN 198 ||+|||||||||| |||||||||+|| |||# |+ |+ +||+||| Sbjct 199 ETIRLVQAFQYTDTHGEVCPAGWRPGADTI#VPDPEEKTKYFAKNN 243 |
| Ascaris suum | Query 154 ETLRLVQAFQYTDEHGEVCPAGWKPGGDTI#KPNVEDSKEYFSKN 197 ||||||||||+ |+||||||||| || |||#|| |++|| || |+ Sbjct 152 ETLRLVQAFQFVDKHGEVCPAGWTPGADTI#KPGVKESKAYFEKH 195 |
| Caenorhabditis elegans | Query 154 ETLRLVQAFQYTDEHGEVCPAGWKPGGDTI#KPNVEDSKEYFSKN 197 ||||||||||+ ++||||||||| || |||#|| |++|+||| |+ Sbjct 152 ETLRLVQAFQFVEKHGEVCPAGWTPGSDTI#KPGVKESQEYFKKH 195 |
| Apis mellifera | Query 154 ETLRLVQAFQYTDEHGEVCPAGWKPGGDTI#KPNVEDSKEYF 194 |||||||||||||+|||||||||||| |+#||+| ||||| Sbjct 151 ETLRLVQAFQYTDKHGEVCPAGWKPGKKTM#KPDVVGSKEYF 191 |
| Scophthalmus maximus | Query 154 ETLRLVQAFQYTDEHGEVCPAGWKPGGDTI#KPNVEDSKEYFSK 196 |+|||+||||+||+|||||||||||| |||# |+|| || +||| Sbjct 154 ESLRLIQAFQHTDKHGEVCPAGWKPGSDTI#IPDVEKSKAFFSK 196 |
| Artemia franciscana | Query 154 ETLRLVQAFQYTDEHGEVCPAGWKPGGDTI#KPNVEDSKEYFSKNN 198 |||||||||||||+|||||||||||| |||# |+ | +|| | | Sbjct 199 ETLRLVQAFQYTDKHGEVCPAGWKPGSDTI#VPHPTDKLKYFGKLN 243 |
| Strongylocentrotus purpuratus | Query 154 ETLRLVQAFQYTDEHGEVCPAGWKPGGDTI#KPNVEDSKEYFSK 196 | ||||||||+||+ ||||||||||| |||#|| |++|||+| | Sbjct 154 EVLRLVQAFQFTDKFGEVCPAGWKPGDDTI#KPGVKESKEFFGK 196 |
| Onchocerca volvulus | Query 154 ETLRLVQAFQYTDEHGEVCPAGWKPGGDTI#KPNVEDSKEYFSKN 197 ||||||||||+ | ||||||| |+|| +||#|| |++||||| |+ Sbjct 156 ETLRLVQAFQFVDNHGEVCPANWQPGSETI#KPEVKESKEYFGKH 199 |
| Caenorhabditis briggsae | Query 154 ETLRLVQAFQYTDEHGEVCPAGWKPGGDTI#KPNVEDSKEYFSKN 197 ||||||||||+ ++||||||||| || |||#||+|+ |+||| |+ Sbjct 532 ETLRLVQAFQFVEKHGEVCPAGWTPGSDTI#KPDVKKSQEYFGKH 575 |
| Onchocerca ochengi | Query 154 ETLRLVQAFQYTDEHGEVCPAGWKPGGDTI#KPNVEDSKEYFSKN 197 |||||+||||+ | ||||||| |+|| +||#|| |++||||| |+ Sbjct 156 ETLRLIQAFQFVDNHGEVCPANWQPGSETI#KPEVKESKEYFGKH 199 |
| Biomphalaria glabrata | Query 154 ETLRLVQAFQYTDEHGEVCPAGWKPGGDTI#KPNVEDSKEYFSKNN 198 |||||||||||||+|||||||||||| ||# |+ + ||||| + + Sbjct 175 ETLRLVQAFQYTDKHGEVCPAGWKPGSATI#IPDPKKSKEYFKQQS 219 |
| Tribolium castaneum | Query 154 ETLRLVQAFQYTDEHGEVCPAGWKPGGDTI#KPNVEDSKEYFSKN 197 |||||||||||||+||||||| |||| |||# || + |+|| |+ Sbjct 200 ETLRLVQAFQYTDKHGEVCPAEWKPGQDTI#IPNPIEKKKYFEKH 243 |
| Bombyx mori | Query 154 ETLRLVQAFQYTDEHGEVCPAGWKP--GGDTI#KPNVEDSKEYFSKNN 198 ||||||+|||+ |+||||||||| | |||#||| +|||||| | | Sbjct 181 ETLRLVKAFQFADKHGEVCPAGWNPDTNADTI#KPNPKDSKEYFQKAN 227 |
| Dirofilaria immitis | Query 154 ETLRLVQAFQYTDEHGEVCPAGWKPGGDTI#KPNVEDSKEYFSKN 197 |||||+||||+ | ||||||| |+|| + |#|| |++|| || |+ Sbjct 156 ETLRLIQAFQFVDNHGEVCPANWQPGSEAI#KPGVKESKAYFEKH 199 |
| Debaryomyces hansenii CBS767 | Query 154 ETLRLVQAFQYTDEHGEVCPAGWKPGGDTI#KPNVEDSKEYFSKNN 198 |+||||+|||+|+++|||||| |+|| +||#|| | ||||| | | Sbjct 151 ESLRLVEAFQFTEKYGEVCPANWQPGSETI#KPEVSSSKEYFGKVN 195 |
| Pichia guilliermondii ATCC 6260 | Query 154 ETLRLVQAFQYTDEHGEVCPAGWKPGGDTI#KPNVEDSKEYFSKNN 198 |+||||+|||+|+++|||||| |+|| +||#|| |+ +|||| | | Sbjct 151 ESLRLVEAFQFTEKYGEVCPANWQPGSETI#KPGVDSAKEYFGKVN 195 |
| Globodera rostochiensis | Query 154 ETLRLVQAFQYTDEHGEVCPAGWKPGGDTI#KPNVEDSKEYFSK 196 |||||||||+||| ||||||| |+|| |||#||+ | |+ +| | Sbjct 155 ETLRLVQAFKYTDTHGEVCPANWQPGEDTI#KPDPEGSQTFFGK 197 |
| Acanthocheilonema viteae | Query 154 ETLRLVQAFQYTDEHGEVCPAGWKPGGDTI#KPNVEDSKEYF 194 |||||+||||+ |+||||||| | || +||#|| |++|| || Sbjct 156 ETLRLIQAFQFVDKHGEVCPANWHPGSETI#KPGVKESKAYF 196 |
| Pichia stipitis CBS 6054 | Query 154 ETLRLVQAFQYTDEHGEVCPAGWKPGGDTI#KPNVEDSKEYFSKNN 198 |+|||++|||+|+++|||||| | || +||#|| | ||||| | | Sbjct 151 ESLRLLEAFQFTEKYGEVCPANWTPGAETI#KPEVSSSKEYFGKVN 195 |
| Paramecium tetraurelia | Query 154 ETLRLVQAFQYTDEHGEVCPAGWKPGGDTI#KPNVEDSKEYFSKN 197 |||||+||||||| ||||||| |||| ||# |+ + |||+|+ Sbjct 185 ETLRLIQAFQYTDTHGEVCPANWKPGQRTI#VPDQDKKAEYFAKS 228 |
| Toxoptera citricida | Query 154 ETLRLVQAFQYTDEHGEVCPAGWKPGGDTI#KPNVEDSKEYF 194 ||||||||||||||||||||| |||| ||# |+ ||+|| Sbjct 151 ETLRLVQAFQYTDEHGEVCPANWKPGSKTI#NPS--KSKDYF 189 |
| Candida albicans SC5314 | Query 154 ETLRLVQAFQYTDEHGEVCPAGWKPGGDTI#KPNVEDSKEYFSKNN 198 |+|||++|||+|+++|||||| | || +||#||+ | |||||+| | Sbjct 151 ESLRLLEAFQFTEKYGEVCPANWHPGDETI#KPSPEASKEYFNKVN 195 |
| Lodderomyces elongisporus NRRL YB-4239 | Query 154 ETLRLVQAFQYTDEHGEVCPAGWKPGGDTI#KPNVEDSKEYFSKNN 198 |+|||++|||+|+++|||||| |+|| +||#| |||||||| | Sbjct 151 ESLRLLEAFQFTEKYGEVCPANWQPGSETI#KATPNDSKEYFSKVN 195 |
| Apis mellifera ligustica | Query 154 ETLRLVQAFQYTDEHGEVCPAGWKPGGDTI#KPNVEDSKEYFSKNN 198 |||||++|||+ ++||||||| |+| ||#||| +|||+|| | Sbjct 198 ETLRLIKAFQFVEKHGEVCPANWQPDSKTI#KPNPKDSKQYFESVN 242 |
| Trypanosoma cruzi strain CL Brener | Query 154 ETLRLVQAFQYTDEHGEVCPAGWKPGGDTI#KPNVEDSKEYF 194 | ||||+|||+ +|||||||| |||| |+#||+ | ||||| Sbjct 155 EALRLVKAFQFVEEHGEVCPANWKPGDKTM#KPDPEKSKEYF 195 |
| Glossina morsitans morsitans | Query 154 ETLRLVQAFQYTDEHGEVCPAGWKPGGDTI#KPNVEDSKEYFSKNN 198 ||||| ||||| | |||||||| ||| |||# | + +||+||| Sbjct 202 ETLRLXQAFQYXDXHGEVCPAGXKPGADTI#VLNPREKAKYFAKNN 246 |
| Schistosoma mansoni | Query 154 ETLRLVQAFQYTDEHGEVCPAGWKPGGDTI#KPNVEDSKEYFSKNN 198 | ||||+||||||++|||||| |+| | ||#||+++ |||| | | Sbjct 175 EVLRLVRAFQYTDKYGEVCPADWQPKGPTI#KPDLKKYKEYFHKVN 219 |
| Schistosoma japonicum | Query 154 ETLRLVQAFQYTDEHGEVCPAGWKPGGDTI#KPNVEDSKEYFSK 196 | ||||+|||+||+||||||| |+| | ||#||+++ |||| | Sbjct 176 EVLRLVRAFQFTDKHGEVCPADWQPKGPTI#KPDLKQYKEYFHK 218 |
| Pongo pygmaeus | Query 154 ETLRLVQAFQYTDEHGEVCPAGWKPGGDTI#KPNVEDSKEYFSKNN 198 ||||||+|||| + ||||||| | | ||#||| ||||| | | Sbjct 211 ETLRLVKAFQYVETHGEVCPANWTPDSPTI#KPNPAASKEYFQKVN 255 |
| Amoeba proteus | Query 154 ETLRLVQAFQYTDEHGEVCPAGWKPGGDTI#KPNVEDSKEYFSK 196 | ||+||||+||+||||||| |+|| ||#||| | ||||+ Sbjct 130 EFKRLIQAFQFTDKHGEVCPASWRPGAATI#KPNPVDKLEYFSQ 172 |
| Yarrowia lipolytica | Query 154 ETLRLVQAFQYTDEHGEVCPAGWKPGGDTI#KPNVEDSKEYFSKNN 198 |||||+ |||+|++||||||| |+ | |||#| + ++|||| | | Sbjct 151 ETLRLIDAFQFTEKHGEVCPANWQKGSDTI#KADPVNAKEYFEKAN 195 |
| Litomosoides sigmodontis | Query 154 ETLRLVQAFQYTDEHGEVCPAGWKPGGDTI#KPNVEDSK 191 |||||+||||+ |+|||+||| |+|| +||#|| |++|| Sbjct 156 ETLRLIQAFQFVDKHGELCPANWQPGSETI#KPGVKESK 193 |
| Maconellicoccus hirsutus | Query 154 ETLRLVQAFQYTDEHGEVCPAGWKPGGDTI#KPNVEDSKEYF 194 ||||||||||+||+||||||| |||| ++#| + + ++||| Sbjct 151 ETLRLVQAFQFTDKHGEVCPANWKPGSKSM#KADPKGAQEYF 191 |
| Taiwanofungus camphoratus | Query 154 ETLRLVQAFQYTDEHGEVCPAGWKPGGDTI#KPNVEDSKEYFS 195 ||+||++|||+|||||||||| | || ||#| + + | |||| Sbjct 152 ETIRLIKAFQFTDEHGEVCPANWTEGGKTI#KADPKGSLEYFS 193 |
| Gibberella zeae PH-1 | Query 154 ETLRLVQAFQYTDEHGEVCPAGWKPGGDTI#KPNVEDSKEYFS 195 ||+|||+|||+|||+||||||||+ || |+#| + + | |||| Sbjct 154 ETIRLVKAFQFTDEYGEVCPAGWQEGGKTM#KADPKGSLEYFS 195 |
| Trypanosoma cruzi | Query 154 ETLRLVQAFQYTDEHGEVCPAGWKPGGDTI#KPNVEDSKEYF 194 | ||||+|||+ ++||||||| |||| +#||+ | ||||| Sbjct 155 EALRLVKAFQFVEKHGEVCPANWKPGDKAM#KPDPEKSKEYF 195 |
| Trypanosoma brucei TREU927 | Query 154 ETLRLVQAFQYTDEHGEVCPAGWKPGGDTI#KPNVEDSKEYFSKNN 198 ||||||+|||+ ++||||||| |||| |+#| + |++||| | Sbjct 155 ETLRLVKAFQFVEKHGEVCPANWKPGSKTM#KADPNGSQDYFSSMN 199 |
| Phaeosphaeria nodorum SN15 | Query 154 ETLRLVQAFQYTDEHGEVCPAGWKPGGDTI#KPNVEDSKEYFSK 196 |||||+ |||+||++|||||| | || +||#| | +||| | Sbjct 160 ETLRLIDAFQFTDKYGEVCPANWNPGDETI#KATPEGNKEYLGK 202 |
| Ostreococcus lucimarinus CCE9901 | Query 154 ETLRLVQAFQYTDEHGEVCPAGWKPGGDTI#KPNVEDSKEYFSK 196 ||||||+||||| |||||||||| || |+# + | || || + Sbjct 150 ETLRLVRAFQYTAEHGEVCPAGWTPGAPTM#IDDPEKSKTYFEQ 192 |
| Drosophila yakuba | Query 154 ETLRLVQAFQYTDEHGEVCPAGWKPGGDTI#KPNVEDSKEYF 194 |||||||||||||++|||||| |||| |+# + ||||| Sbjct 150 ETLRLVQAFQYTDKYGEVCPANWKPGQKTM#VADPTKSKEYF 190 |
| Saccharomyces cerevisiae | Query 154 ETLRLVQAFQYTDEHGEVCPAGWKPGGDTI#KPNVEDSKEYFSKNN 198 | ||||+|||+||++| | | | || ||#|| |||||||| | Sbjct 151 EALRLVEAFQWTDKNGTVLPCNWTPGAATI#KPTVEDSKEYFEAAN 195 |
| Candida glabrata | Query 154 ETLRLVQAFQYTDEHGEVCPAGWKPGGDTI#KPNVEDSKEYFSKNN 198 |+||||+ ||+||++| | | | || ||#|| |||||||| + | Sbjct 151 ESLRLVEGFQWTDKNGTVLPCNWTPGSATI#KPTVEDSKEYFKEAN 195 |
| Moniliophthora perniciosa | Query 154 ETLRLVQAFQYTDEHGEVCPAGWKPGGDTI#KPNVEDSKEYF 194 ||+|||+|||+||+||||||| | || ||#| + + | ||| Sbjct 152 ETIRLVKAFQFTDKHGEVCPANWSEGGKTI#KADPKSSLEYF 192 |
| Ostreococcus tauri | Query 154 ETLRLVQAFQYTDEHGEVCPAGWKPGGDTI#KPNVEDSKEYF 194 |||||++| ||| |||||||||| || |+# + | ||||| Sbjct 8 ETLRLLRAIQYTKEHGEVCPAGWTPGDPTM#VGDPEKSKEYF 48 |
| Taenia solium | Query 154 ETLRLVQAFQYTDEHGEVCPAGWKPGGDTI#KPNVEDSKEYFS 195 | |||+ |||+||+||||||| |+|| #||| | | + | Sbjct 154 EALRLLDAFQFTDKHGEVCPANWRPGSKAF#KPNAGDLKSFMS 195 |
| Tetrahymena thermophila SB210 | Query 154 ETLRLVQAFQYTDEHGEVCPAGWKPGGDTI#KPNVEDSKEYFS 195 |||||++|||+|| ||||||| |+|| ||# |+ + +||| Sbjct 186 ETLRLIKAFQHTDTHGEVCPANWQPGQKTI#IPDQDQKIKYFS 227 |
| Entamoeba moshkovskii | Query 154 ETLRLVQAFQYTDEHGEVCPAGWKPGGDTI#KPNVEDSKEYFSKN 197 ||+|+|+| |+||+|| ||| |||| |||#+|+ + |+| | + Sbjct 174 ETIRIVKAIQFTDQHGAVCPLNWKPGNDTI#EPSHDGIKKYLSSH 217 |
| Echinococcus granulosus | Query 154 ETLRLVQAFQYTDEHGEVCPAGWKPGGDTI#KPNVEDSKEYFS 195 | |||+ |||+||+||||||| |+|| | #||+ | | + | Sbjct 151 EALRLLDAFQFTDKHGEVCPANWQPGSKTF#KPSAGDLKSFMS 192 |
| Echinococcus multilocularis | Query 154 ETLRLVQAFQYTDEHGEVCPAGWKPGGDTI#KPNVEDSKEYFS 195 | |||+ |||+||+||||||| | || | #||+ | | + | Sbjct 151 EALRLLDAFQFTDKHGEVCPANWHPGSKTF#KPSAGDLKSFMS 192 |
| Nitrosococcus oceani ATCC 19707 | Query 154 ETLRLVQAFQYTDEHGEVCPAGWKPGGDTI#KPNVEDSKEYFSKN 197 | ||+| | |+|+||||||||||+ | + |#+|+ | || ||+ Sbjct 152 EMLRVVDALQFTEEHGEVCPAGWRKGEEAI#RPDAEGVAEYLSKH 195 |
| Kluyveromyces lactis | Query 154 ETLRLVQAFQYTDEHGEVCPAGWKPGGDTI#KPNVEDSKEYFSKNN 198 | ||||+ ||+||++| | | | || ||#|| |+ |||||| | Sbjct 151 EALRLVEGFQWTDKNGTVLPCNWTPGAATI#KPEVDASKEYFSSVN 195 |
| Phanerochaete chrysosporium | Query 154 ETLRLVQAFQYTDEHGEVCPAGWKPGGDTI#KPNVEDSKEYFSKNN 198 ||+||++|||+ +++|||||| || || |+#| + + | |||| | Sbjct 152 ETIRLIKAFQFVEKYGEVCPANWKEGGKTM#KADPKGSLEYFSTVN 196 |
| Trichomonas vaginalis G3 | Query 154 ETLRLVQAFQYTDEHGEVCPAGWKPGGD-TI#KPNVEDSKEYFSKNN 198 | ||||+|+|+ +||||||| | || ||#||| + ||||| | | Sbjct 150 EILRLVKAYQFAAKHGEVCPAQWHGEGDLTI#KPNPKASKEYFGKAN 195 |
| Cryptococcus neoformans var. neoformans JEC21 | Query 154 ETLRLVQAFQYTDEHGEVCPAGWKPGGDTI#KPNVEDSKEYFSK 196 ||+|+++|||+||||||||||||+ | |||# + + |||| Sbjct 156 ETIRVIKAFQFTDEHGEVCPAGWEEGKDTI#DTSAPSA--YFSK 196 |
| Cryptococcus neoformans var. grubii | Query 154 ETLRLVQAFQYTDEHGEVCPAGWKPGGDTI#KPNVEDSKEYFSK 196 ||+|+++|||+||||||||||||+ | |||# + + |||| Sbjct 156 ETIRVIKAFQFTDEHGEVCPAGWEEGKDTI#DTSAPSA--YFSK 196 |
| Oryza sativa (japonica cultivar-group) | Query 154 ETLRLVQAFQYTDEH-GEVCPAGWKPGGDTI#KPNVEDSKEYFS 195 |||| +|| || |+ |||||||||| ++#||+ +||||||+ Sbjct 123 ETLRTLQALQYVQENPDEVCPAGWKPGEKSM#KPDPKDSKEYFA 165 |
| Oryza sativa (indica cultivar-group) | Query 154 ETLRLVQAFQYTDEH-GEVCPAGWKPGGDTI#KPNVEDSKEYFS 195 |||| +|| || |+ |||||||||| ++#||+ +||||||+ Sbjct 119 ETLRTLQALQYVQENPDEVCPAGWKPGEKSM#KPDPKDSKEYFA 161 |
| Entamoeba histolytica HM-1:IMSS | Query 154 ETLRLVQAFQYTDEHGEVCPAGWKPGGDTI#KPNVEDSKEYFS 195 ||+|+|+| |++|||| ||| |||| |||#+| + |+| + Sbjct 186 ETIRIVKAIQFSDEHGAVCPLNWKPGKDTI#EPTPDGIKKYLT 227 |
| Entamoeba histolytica | Query 154 ETLRLVQAFQYTDEHGEVCPAGWKPGGDTI#KPNVEDSKEYFS 195 ||+|+|+| |++|||| ||| |||| |||#+| + |+| + Sbjct 166 ETIRIVKAIQFSDEHGAVCPLNWKPGKDTI#EPTSDGIKKYLT 207 |
| Spinacia oleracea | Query 154 ETLRLVQAFQYTDEHGEVCPAGWKPGGDTI#KPNVEDSKEYFS 195 ||+| +|| ||| |||||||||| ++#||+ + |||||| Sbjct 222 ETMRTLQALQYTGNPDEVCPAGWKPGEKSM#KPDPKLSKEYFS 263 |
| Ashbya gossypii ATCC 10895 | Query 154 ETLRLVQAFQYTDEHGEVCPAGWKPGGDTI#KPNVEDSKEYFSK 196 | ||||+ ||+||++| | | | || ||#||+| ||||||+ Sbjct 151 EALRLVEGFQWTDKNGTVLPCNWTPGAATI#KPDVAASKEYFSE 193 |
[Site 4] PAGWKPGGDT182-IKPNVEDSKE
Thr182 Ile
|
|||||||||
| P10 | P9 | P8 | P7 | P6 | P5 | P4 | P3 | P2 | P1 |
|---|---|---|---|---|---|---|---|---|---|
| Pro173 | Ala174 | Gly175 | Trp176 | Lys177 | Pro178 | Gly179 | Gly180 | Asp181 | Thr182 |
|
|||||||||
| P1' | P2' | P3' | P4' | P5' | P6' | P7' | P8' | P9' | P10' |
| Ile183 | Lys184 | Pro185 | Asn186 | Val187 | Glu188 | Asp189 | Ser190 | Lys191 | Glu192 |
Sequence conservation (by blast) Sequence conservation (by blast)
| Reference peptide (cleaved bond±30 residues) |
|---|
| DETLRLVQAFQYTDEHGEVCPAGWKPGGDTIKPNVEDSKEYFSKNN |
Summary
| # | organism | max score | hits | top seq |
|---|---|---|---|---|
| 1 | N/A | 103.00 | 16 | - |
| 2 | Mus musculus | 95.90 | 16 | Prdx2 protein |
| 3 | Homo sapiens | 95.90 | 15 | peroxiredoxin 2 isoform a |
| 4 | Macaca mulatta | 95.90 | 8 | PREDICTED: peroxiredoxin 2 isoform 3 |
| 5 | synthetic construct | 95.90 | 8 | peroxiredoxin 2 |
| 6 | Rattus norvegicus | 95.90 | 7 | peroxiredoxin 2 |
| 7 | Cricetulus griseus | 95.90 | 2 | PRDX2_CRIGR Peroxiredoxin-2 gb |
| 8 | Bos taurus | 93.60 | 5 | peroxiredoxin 2 |
| 9 | Xenopus tropicalis | 88.20 | 4 | peroxiredoxin 2 |
| 10 | Branchiostoma belcheri tsingtaunese | 87.80 | 1 | thioredoxin peroxidase |
| 11 | Canis familiaris | 87.40 | 9 | PREDICTED: similar to peroxiredoxin 1 |
| 12 | Gallus gallus | 87.40 | 6 | PREDICTED: similar to natural killer cell enhancin |
| 13 | Pan troglodytes | 87.40 | 6 | PREDICTED: similar to proliferation associated gen |
| 14 | Macaca fascicularis | 87.40 | 4 | unnamed protein product |
| 15 | Myotis lucifugus | 87.40 | 1 | PRDX1_MYOLU Peroxiredoxin-1 gb |
| 16 | Monodelphis domestica | 86.70 | 3 | PREDICTED: similar to proliferation associated gen |
| 17 | Gekko japonicus | 86.30 | 1 | PRDX1_GECJA Peroxiredoxin-1 gb |
| 18 | Cyprinus carpio | 86.30 | 1 | natural killer cell enhancing factor |
| 19 | Ictalurus punctatus | 86.30 | 1 | natural killer cell enhancing factor |
| 20 | Xenopus laevis | 85.90 | 7 | MGC83078 protein |
| 21 | Danio rerio | 85.90 | 5 | hypothetical protein LOC541344 |
| 22 | Ixodes scapularis | 85.90 | 3 | thioredoxin peroxidase |
| 23 | Ciona intestinalis | 85.50 | 1 | peroxiredoxin-like |
| 24 | Tetraodon nigroviridis | 84.70 | 3 | unnamed protein product |
| 25 | Oncorhynchus mykiss | 84.70 | 1 | AF250193_1 natural killer cell enhancement factor |
| 26 | Spermophilus tridecemlineatus | 84.70 | 1 | peroxiredoxin 2 |
| 27 | Ostertagia ostertagi | 84.30 | 1 | thioredoxin peroxidase |
| 28 | Drosophila melanogaster | 83.60 | 4 | thioredoxin peroxidase 2 CG1274-PA, isoform A |
| 29 | Aedes aegypti | 83.20 | 3 | peroxiredoxins, prx-1, prx-2, prx-3 |
| 30 | Paralichthys olivaceus | 83.20 | 1 | natural killer enhancing factor |
| 31 | Haemonchus contortus | 82.80 | 1 | peroxiredoxin |
| 32 | Anopheles gambiae str. PEST | 82.40 | 3 | ENSANGP00000010951 |
| 33 | Cynops pyrrhogaster | 82.40 | 1 | TDX_CYNPY Peroxiredoxin (Thioredoxin peroxidase) ( |
| 34 | Drosophila pseudoobscura | 81.60 | 3 | GA11781-PA |
| 35 | Apis mellifera | 79.30 | 2 | PREDICTED: similar to thioredoxin peroxidase 1 CG1 |
| 36 | Caenorhabditis elegans | 79.30 | 2 | PeRoxireDoXin family member (prdx-2) |
| 37 | Artemia franciscana | 79.30 | 1 | thioredoxin peroxidase |
| 38 | Scophthalmus maximus | 79.30 | 1 | natural killer enhancing factor |
| 39 | Strongylocentrotus purpuratus | 79.00 | 3 | PREDICTED: similar to thioredoxin peroxidase |
| 40 | Onchocerca volvulus | 79.00 | 2 | peroxidoxin-2 |
| 41 | Caenorhabditis briggsae | 78.60 | 2 | Hypothetical protein CBG02380 |
| 42 | Onchocerca ochengi | 78.60 | 1 | peroxidoxin-2 |
| 43 | Ascaris suum | 77.80 | 1 | PRDX_ASCSU Peroxiredoxin (AsPrx) (Thioredoxin pero |
| 44 | Biomphalaria glabrata | 77.40 | 1 | thioredoxin peroxidase BgTPx |
| 45 | Tribolium castaneum | 76.60 | 4 | PREDICTED: similar to Peroxiredoxin-4 (Prx-IV) (Th |
| 46 | Bombyx mori | 76.60 | 2 | thioredoxin peroxidase |
| 47 | Dirofilaria immitis | 74.30 | 2 | thioredoxin peroxidase |
| 48 | Globodera rostochiensis | 73.90 | 1 | peroxiredoxin |
| 49 | Acanthocheilonema viteae | 73.60 | 1 | thiredoxin peroxidase |
| 50 | Debaryomyces hansenii CBS767 | 72.80 | 1 | hypothetical protein DEHA0G11154g |
| 51 | Pichia guilliermondii ATCC 6260 | 72.40 | 1 | peroxiredoxin TSA1 |
| 52 | Paramecium tetraurelia | 71.60 | 8 | hypothetical protein |
| 53 | Toxoptera citricida | 71.60 | 1 | putative cytosolic thioredoxin peroxidase |
| 54 | Apis mellifera ligustica | 71.20 | 1 | thioredoxin peroxidase |
| 55 | Trypanosoma cruzi strain CL Brener | 70.90 | 4 | tryparedoxin peroxidase |
| 56 | Glossina morsitans morsitans | 70.90 | 3 | putative thioredoxin peroxidase 2 |
| 57 | Schistosoma mansoni | 70.90 | 1 | AF301001_1 thioredoxin peroxidase 3 |
| 58 | Pichia stipitis CBS 6054 | 70.90 | 1 | Peroxiredoxin TSA1 |
| 59 | Schistosoma japonicum | 70.90 | 1 | SJCHGC01281 protein |
| 60 | Lodderomyces elongisporus NRRL YB-4239 | 70.10 | 1 | peroxiredoxin TSA1 |
| 61 | Candida albicans SC5314 | 70.10 | 1 | putative thioredoxin peroxidase |
| 62 | Pongo pygmaeus | 69.30 | 1 | PRDX3_PONPY Thioredoxin-dependent peroxide reducta |
| 63 | Amoeba proteus | 68.90 | 1 | peroxiredoxin |
| 64 | Litomosoides sigmodontis | 68.60 | 1 | AF105258_1 peroxidoxin-2 |
| 65 | Maconellicoccus hirsutus | 67.80 | 1 | putative cytosolic thioredoxin peroxidase |
| 66 | Taiwanofungus camphoratus | 67.80 | 1 | peroxiredoxin |
| 67 | Yarrowia lipolytica | 67.80 | 1 | hypothetical protein |
| 68 | Trypanosoma cruzi | 67.40 | 1 | AF320771_1 tryparedoxin peroxidase |
| 69 | Trypanosoma brucei TREU927 | 67.00 | 2 | tryparedoxin peroxidase |
| 70 | Ostreococcus lucimarinus CCE9901 | 67.00 | 1 | predicted protein |
| 71 | Saccharomyces cerevisiae | 67.00 | 1 | Tsa1p |
| 72 | Phaeosphaeria nodorum SN15 | 67.00 | 1 | hypothetical protein SNOG_00334 |
| 73 | Gibberella zeae PH-1 | 66.20 | 1 | hypothetical protein FG03180.1 |
| 74 | Drosophila yakuba | 65.50 | 1 | similar to Drosophila melanogaster Jafrac1 |
| 75 | Ostreococcus tauri | 65.50 | 1 | thioredoxin I (ISS) |
| 76 | Candida glabrata | 65.10 | 2 | unnamed protein product |
| 77 | Taenia solium | 64.30 | 1 | 2-Cys peroxiredoxin |
| 78 | Moniliophthora perniciosa | 64.30 | 1 | cys 2 peroxiredoxin |
| 79 | Entamoeba moshkovskii | 63.90 | 3 | peroxiredoxin |
| 80 | Echinococcus granulosus | 63.90 | 2 | TDX_ECHGR Thioredoxin peroxidase (Peroxiredoxin) ( |
| 81 | Echinococcus multilocularis | 63.20 | 1 | thioredoxin peroxidase |
| 82 | Tetrahymena thermophila SB210 | 62.40 | 3 | AhpC/TSA family protein |
| 83 | Phanerochaete chrysosporium | 62.40 | 1 | peroxiredoxins |
| 84 | Trichomonas vaginalis G3 | 62.00 | 3 | thioredoxin peroxidase |
| 85 | Oryza sativa (japonica cultivar-group) | 61.60 | 2 | OJ991214_12.15 |
| 86 | Oryza sativa (indica cultivar-group) | 61.60 | 1 | hypothetical protein OsI_015300 |
| 87 | Nitrosococcus oceani ATCC 19707 | 61.60 | 1 | Alkyl hydroperoxide reductase/ Thiol specific anti |
| 88 | Spinacia oleracea | 61.20 | 1 | BAS1_SPIOL 2-Cys peroxiredoxin BAS1, chloroplast p |
| 89 | Ashbya gossypii ATCC 10895 | 61.20 | 1 | AER312Wp |
| 90 | Kluyveromyces lactis | 61.20 | 1 | unnamed protein product |
| 91 | Brugia malayi | 60.80 | 1 | TDX1_BRUMA Thioredoxin peroxidase 1 (Peroxiredoxin |
| 92 | Leptospira borgpetersenii serovar Hardjo-bovis L550 | 60.50 | 1 | Peroxiredoxin |
| 93 | Cryptococcus neoformans var. grubii | 60.50 | 1 | thiol-specific antioxidant protein 1 |
| 94 | Cryptococcus neoformans var. neoformans JEC21 | 60.50 | 1 | thioredoxin-dependent peroxide reductase |
| 95 | Hordeum vulgare subsp. vulgare | 60.50 | 1 | BAS1_HORVU 2-Cys peroxiredoxin BAS1, chloroplast p |
| 96 | Prochlorococcus marinus str. NATL2A | 60.10 | 1 | thioredoxin peroxidase |
| 97 | Chlorobium ferrooxidans DSM 13031 | 59.70 | 1 | Alkyl hydroperoxide reductase/ Thiol specific anti |
| 98 | Entamoeba histolytica | 59.70 | 1 | 30 kDa type I collagen binding protein |
Top-ranked sequences
| organism | matching |
|---|---|
| N/A | Query 153 DETLRLVQAFQYTDEHGEVCPAGWKPGGDT#IKPNVEDSKEYFSKNN 198 ||||||||||||||||||||||||||||||#|||||||||||||||| Query 153 DETLRLVQAFQYTDEHGEVCPAGWKPGGDT#IKPNVEDSKEYFSKNN 198 |
| Mus musculus | Query 153 DETLRLVQAFQYTDEHGEVCPAGWKPGGDT#IKPNVEDSKEYFSKNN 198 || |||||||||||||||||||||||| ||#|||||+||||||||+| Sbjct 153 DEALRLVQAFQYTDEHGEVCPAGWKPGSDT#IKPNVDDSKEYFSKHN 198 |
| Homo sapiens | Query 153 DETLRLVQAFQYTDEHGEVCPAGWKPGGDT#IKPNVEDSKEYFSKNN 198 || |||||||||||||||||||||||| ||#|||||+||||||||+| Sbjct 153 DEALRLVQAFQYTDEHGEVCPAGWKPGSDT#IKPNVDDSKEYFSKHN 198 |
| Macaca mulatta | Query 153 DETLRLVQAFQYTDEHGEVCPAGWKPGGDT#IKPNVEDSKEYFSKNN 198 || |||||||||||||||||||||||| ||#|||||+||||||||+| Sbjct 103 DEALRLVQAFQYTDEHGEVCPAGWKPGSDT#IKPNVDDSKEYFSKHN 148 |
| synthetic construct | Query 153 DETLRLVQAFQYTDEHGEVCPAGWKPGGDT#IKPNVEDSKEYFSKNN 198 || |||||||||||||||||||||||| ||#|||||+||||||||+| Sbjct 153 DEALRLVQAFQYTDEHGEVCPAGWKPGSDT#IKPNVDDSKEYFSKHN 198 |
| Rattus norvegicus | Query 153 DETLRLVQAFQYTDEHGEVCPAGWKPGGDT#IKPNVEDSKEYFSKNN 198 || |||||||||||||||||||||||| ||#|||||+||||||||+| Sbjct 153 DEALRLVQAFQYTDEHGEVCPAGWKPGSDT#IKPNVDDSKEYFSKHN 198 |
| Cricetulus griseus | Query 153 DETLRLVQAFQYTDEHGEVCPAGWKPGGDT#IKPNVEDSKEYFSKNN 198 || |||||||||||||||||||||||| ||#|||||+||||||||+| Sbjct 153 DEALRLVQAFQYTDEHGEVCPAGWKPGSDT#IKPNVDDSKEYFSKHN 198 |
| Bos taurus | Query 153 DETLRLVQAFQYTDEHGEVCPAGWKPGGDT#IKPNVEDSKEYFSKNN 198 || ||||||||||||||||||||| || ||#|||||+||||||||+| Sbjct 154 DEALRLVQAFQYTDEHGEVCPAGWTPGSDT#IKPNVDDSKEYFSKHN 199 |
| Xenopus tropicalis | Query 153 DETLRLVQAFQYTDEHGEVCPAGWKPGGDT#IKPNVEDSKEYFSK 196 +|||||||||||||+|||||||||||| |#|||||+||||+||| Sbjct 161 EETLRLVQAFQYTDQHGEVCPAGWKPGSST#IKPNVKDSKEFFSK 204 |
| Branchiostoma belcheri tsingtaunese | Query 153 DETLRLVQAFQYTDEHGEVCPAGWKPGGDT#IKPNVEDSKEYFSK 196 |||||||||||+||+|||||||||||| ||#|||+|++||||||| Sbjct 154 DETLRLVQAFQFTDKHGEVCPAGWKPGADT#IKPDVKNSKEYFSK 197 |
| Canis familiaris | Query 153 DETLRLVQAFQYTDEHGEVCPAGWKPGGDT#IKPNVEDSKEYFSK 196 |||||||||||+||+|||||||||||| ||#|||+|+ ||||||| Sbjct 154 DETLRLVQAFQFTDKHGEVCPAGWKPGSDT#IKPDVQKSKEYFSK 197 |
| Gallus gallus | Query 153 DETLRLVQAFQYTDEHGEVCPAGWKPGGDT#IKPNVEDSKEYFSK 196 |||||||||||+||+|||||||||||| ||#|||+|+ ||||||| Sbjct 154 DETLRLVQAFQFTDKHGEVCPAGWKPGSDT#IKPDVQKSKEYFSK 197 |
| Pan troglodytes | Query 153 DETLRLVQAFQYTDEHGEVCPAGWKPGGDT#IKPNVEDSKEYFSK 196 |||||||||||+||+|||||||||||| ||#|||+|+ ||||||| Sbjct 103 DETLRLVQAFQFTDKHGEVCPAGWKPGSDT#IKPDVQKSKEYFSK 146 |
| Macaca fascicularis | Query 153 DETLRLVQAFQYTDEHGEVCPAGWKPGGDT#IKPNVEDSKEYFSK 196 |||||||||||+||+|||||||||||| ||#|||+|+ ||||||| Sbjct 150 DETLRLVQAFQFTDKHGEVCPAGWKPGSDT#IKPDVQKSKEYFSK 193 |
| Myotis lucifugus | Query 153 DETLRLVQAFQYTDEHGEVCPAGWKPGGDT#IKPNVEDSKEYFSK 196 |||||||||||+||+|||||||||||| ||#|||+|+ ||||||| Sbjct 154 DETLRLVQAFQFTDKHGEVCPAGWKPGSDT#IKPDVQKSKEYFSK 197 |
| Monodelphis domestica | Query 153 DETLRLVQAFQYTDEHGEVCPAGWKPGGDT#IKPNVEDSKEYFSKNN 198 ||||||+||||+||++||||||||||| ||#|||+|+ ||||||| | Sbjct 154 DETLRLIQAFQFTDKYGEVCPAGWKPGSDT#IKPDVKGSKEYFSKQN 199 |
| Gekko japonicus | Query 153 DETLRLVQAFQYTDEHGEVCPAGWKPGGDT#IKPNVEDSKEYFSKN 197 |||||||||||+||+|||||||||+|| ||#|||+|+ |||||||+ Sbjct 154 DETLRLVQAFQFTDKHGEVCPAGWQPGSDT#IKPDVQKSKEYFSKH 198 |
| Cyprinus carpio | Query 153 DETLRLVQAFQYTDEHGEVCPAGWKPGGDT#IKPNVEDSKEYFSKNN 198 |||||||||||+||+|||||||||||| ||#|||+|+ ||+|||| + Sbjct 154 DETLRLVQAFQFTDKHGEVCPAGWKPGKDT#IKPDVQQSKDYFSKQH 199 |
| Ictalurus punctatus | Query 153 DETLRLVQAFQYTDEHGEVCPAGWKPGGDT#IKPNVEDSKEYFSKNN 198 |||||||||||+||+|||||||||||| ||#|||+|+ ||++||| | Sbjct 154 DETLRLVQAFQFTDKHGEVCPAGWKPGKDT#IKPDVQKSKDFFSKQN 199 |
| Xenopus laevis | Query 153 DETLRLVQAFQYTDEHGEVCPAGWKPGGDT#IKPNVEDSKEYFSK 196 |||||||||||||| |||||||||||| #|||||+||||+||| Sbjct 157 DETLRLVQAFQYTDVHGEVCPAGWKPGSSI#IKPNVKDSKEFFSK 200 |
| Danio rerio | Query 153 DETLRLVQAFQYTDEHGEVCPAGWKPGGDT#IKPNVEDSKEYFSKNN 198 |||||||||||+||+|||||||||||| ||#|||+| ||++||| | Sbjct 154 DETLRLVQAFQFTDKHGEVCPAGWKPGKDT#IKPDVNQSKDFFSKQN 199 |
| Ixodes scapularis | Query 153 DETLRLVQAFQYTDEHGEVCPAGWKPGGDT#IKPNVEDSKEYFSK 196 ||||||||||||||+|||||||||||||||#| || || +|||| Sbjct 204 DETLRLVQAFQYTDKHGEVCPAGWKPGGDT#IIPNPEDKLKYFSK 247 |
| Ciona intestinalis | Query 153 DETLRLVQAFQYTDEHGEVCPAGWKPGGDT#IKPNVEDSKEYFSK 196 |||||||+|||+||+|||||||||||| ||#|||+|+||++|||| Sbjct 153 DETLRLVKAFQFTDQHGEVCPAGWKPGDDT#IKPDVQDSQKYFSK 196 |
| Tetraodon nigroviridis | Query 153 DETLRLVQAFQYTDEHGEVCPAGWKPGGDT#IKPNVEDSKEYFSKN 197 +||||||||||+||+|||||||||||| ||#|||+|+ |||+|||+ Sbjct 154 EETLRLVQAFQFTDKHGEVCPAGWKPGSDT#IKPDVQKSKEFFSKH 198 |
| Oncorhynchus mykiss | Query 153 DETLRLVQAFQYTDEHGEVCPAGWKPGGDT#IKPNVEDSKEYFSK 196 |||||||||||+||+|||||||||||| ||#|||+|+ ||++||| Sbjct 154 DETLRLVQAFQFTDKHGEVCPAGWKPGSDT#IKPDVQKSKDFFSK 197 |
| Spermophilus tridecemlineatus | Query 153 DETLRLVQAFQYTDEHGEVCPAGWKPGGDT#IKPNVEDSKE 192 || |||||||||||||||||||||||| ||#|||||+|||| Sbjct 62 DEALRLVQAFQYTDEHGEVCPAGWKPGSDT#IKPNVDDSKE 101 |
| Ostertagia ostertagi | Query 153 DETLRLVQAFQYTDEHGEVCPAGWKPGGDT#IKPNVEDSKEYFSKNN 198 |||||||||||| |+||||||||| || |#||| |+|||||||| | Sbjct 148 DETLRLVQAFQYVDKHGEVCPAGWTPGKAT#IKPGVKDSKEYFSKAN 193 |
| Drosophila melanogaster | Query 153 DETLRLVQAFQYTDEHGEVCPAGWKPGGDT#IKPNVEDSKEYFSKNN 198 |||+|||||||||| |||||||||+|| ||#| || |+ +||+||| Sbjct 197 DETIRLVQAFQYTDTHGEVCPAGWRPGADT#IVPNPEEKTKYFAKNN 242 |
| Aedes aegypti | Query 153 DETLRLVQAFQYTDEHGEVCPAGWKPGGDT#IKPNVEDSKEYFSKNN 198 ||||||||||||||+|||||||||||| ||#| || |+ +|| ||+ Sbjct 210 DETLRLVQAFQYTDKHGEVCPAGWKPGQDT#IVPNPEEKMKYFEKNH 255 |
| Paralichthys olivaceus | Query 153 DETLRLVQAFQYTDEHGEVCPAGWKPGGDT#IKPNVEDSKEYFSK 196 +||||||||||+||+|||||||||||| ||#|||+|+ ||++||| Sbjct 154 EETLRLVQAFQFTDKHGEVCPAGWKPGSDT#IKPDVQKSKDFFSK 197 |
| Haemonchus contortus | Query 153 DETLRLVQAFQYTDEHGEVCPAGWKPGGDT#IKPNVEDSKEYFSKNN 198 |||||||||||| |+||||||||| || +|#||| |++|+||||| | Sbjct 151 DETLRLVQAFQYVDKHGEVCPAGWTPGKET#IKPRVKESQEYFSKAN 196 |
| Anopheles gambiae str. PEST | Query 153 DETLRLVQAFQYTDEHGEVCPAGWKPGGDT#IKPNVEDSKEYFSKNN 198 ||||||||||||||+|||||||||||| ||#| || |+ +|| ||+ Sbjct 205 DETLRLVQAFQYTDKHGEVCPAGWKPGQDT#IVPNPEEKIKYFEKNH 250 |
| Cynops pyrrhogaster | Query 153 DETLRLVQAFQYTDEHGEVCPAGWKPGGDT#IKPNVEDSKEYFSK 196 |||||||||||+||+ ||||||||||| ||#|||++ ||||||| Sbjct 154 DETLRLVQAFQHTDKFGEVCPAGWKPGSDT#IKPDISKSKEYFSK 197 |
| Drosophila pseudoobscura | Query 153 DETLRLVQAFQYTDEHGEVCPAGWKPGGDT#IKPNVEDSKEYFSKNN 198 |||+|||||||||| |||||||||+|| ||#| |+ |+ +||+||| Sbjct 198 DETIRLVQAFQYTDTHGEVCPAGWRPGADT#IVPDPEEKTKYFAKNN 243 |
| Apis mellifera | Query 153 DETLRLVQAFQYTDEHGEVCPAGWKPGGDT#IKPNVEDSKEYF 194 ||||||||||||||+|||||||||||| |#+||+| ||||| Sbjct 150 DETLRLVQAFQYTDKHGEVCPAGWKPGKKT#MKPDVVGSKEYF 191 |
| Caenorhabditis elegans | Query 153 DETLRLVQAFQYTDEHGEVCPAGWKPGGDT#IKPNVEDSKEYFSKN 197 |||||||||||+ ++||||||||| || ||#||| |++|+||| |+ Sbjct 151 DETLRLVQAFQFVEKHGEVCPAGWTPGSDT#IKPGVKESQEYFKKH 195 |
| Artemia franciscana | Query 153 DETLRLVQAFQYTDEHGEVCPAGWKPGGDT#IKPNVEDSKEYFSKNN 198 ||||||||||||||+|||||||||||| ||#| |+ | +|| | | Sbjct 198 DETLRLVQAFQYTDKHGEVCPAGWKPGSDT#IVPHPTDKLKYFGKLN 243 |
| Scophthalmus maximus | Query 153 DETLRLVQAFQYTDEHGEVCPAGWKPGGDT#IKPNVEDSKEYFSK 196 ||+|||+||||+||+|||||||||||| ||#| |+|| || +||| Sbjct 153 DESLRLIQAFQHTDKHGEVCPAGWKPGSDT#IIPDVEKSKAFFSK 196 |
| Strongylocentrotus purpuratus | Query 153 DETLRLVQAFQYTDEHGEVCPAGWKPGGDT#IKPNVEDSKEYFSK 196 || ||||||||+||+ ||||||||||| ||#||| |++|||+| | Sbjct 153 DEVLRLVQAFQFTDKFGEVCPAGWKPGDDT#IKPGVKESKEFFGK 196 |
| Onchocerca volvulus | Query 153 DETLRLVQAFQYTDEHGEVCPAGWKPGGDT#IKPNVEDSKEYFSKN 197 |||||||||||+ | ||||||| |+|| +|#||| |++||||| |+ Sbjct 155 DETLRLVQAFQFVDNHGEVCPANWQPGSET#IKPEVKESKEYFGKH 199 |
| Caenorhabditis briggsae | Query 153 DETLRLVQAFQYTDEHGEVCPAGWKPGGDT#IKPNVEDSKEYFSKN 197 |||||||||||+ ++||||||||| || ||#|||+|+ |+||| |+ Sbjct 531 DETLRLVQAFQFVEKHGEVCPAGWTPGSDT#IKPDVKKSQEYFGKH 575 |
| Onchocerca ochengi | Query 153 DETLRLVQAFQYTDEHGEVCPAGWKPGGDT#IKPNVEDSKEYFSKN 197 ||||||+||||+ | ||||||| |+|| +|#||| |++||||| |+ Sbjct 155 DETLRLIQAFQFVDNHGEVCPANWQPGSET#IKPEVKESKEYFGKH 199 |
| Ascaris suum | Query 154 ETLRLVQAFQYTDEHGEVCPAGWKPGGDT#IKPNVEDSKEYFSKN 197 ||||||||||+ |+||||||||| || ||#||| |++|| || |+ Sbjct 152 ETLRLVQAFQFVDKHGEVCPAGWTPGADT#IKPGVKESKAYFEKH 195 |
| Biomphalaria glabrata | Query 153 DETLRLVQAFQYTDEHGEVCPAGWKPGGDT#IKPNVEDSKEYFSKNN 198 ||||||||||||||+|||||||||||| |#| |+ + ||||| + + Sbjct 174 DETLRLVQAFQYTDKHGEVCPAGWKPGSAT#IIPDPKKSKEYFKQQS 219 |
| Tribolium castaneum | Query 153 DETLRLVQAFQYTDEHGEVCPAGWKPGGDT#IKPNVEDSKEYFSKN 197 ||||||||||||||+||||||| |||| ||#| || + |+|| |+ Sbjct 199 DETLRLVQAFQYTDKHGEVCPAEWKPGQDT#IIPNPIEKKKYFEKH 243 |
| Bombyx mori | Query 153 DETLRLVQAFQYTDEHGEVCPAGWKP--GGDT#IKPNVEDSKEYFSKNN 198 |||||||+|||+ |+||||||||| | ||#|||| +|||||| | | Sbjct 180 DETLRLVKAFQFADKHGEVCPAGWNPDTNADT#IKPNPKDSKEYFQKAN 227 |
| Dirofilaria immitis | Query 153 DETLRLVQAFQYTDEHGEVCPAGWKPGGDT#IKPNVEDSKEYFSKN 197 ||||||+||||+ | ||||||| |+|| + #||| |++|| || |+ Sbjct 155 DETLRLIQAFQFVDNHGEVCPANWQPGSEA#IKPGVKESKAYFEKH 199 |
| Globodera rostochiensis | Query 153 DETLRLVQAFQYTDEHGEVCPAGWKPGGDT#IKPNVEDSKEYFSK 196 ||||||||||+||| ||||||| |+|| ||#|||+ | |+ +| | Sbjct 154 DETLRLVQAFKYTDTHGEVCPANWQPGEDT#IKPDPEGSQTFFGK 197 |
| Acanthocheilonema viteae | Query 153 DETLRLVQAFQYTDEHGEVCPAGWKPGGDT#IKPNVEDSKEYF 194 ||||||+||||+ |+||||||| | || +|#||| |++|| || Sbjct 155 DETLRLIQAFQFVDKHGEVCPANWHPGSET#IKPGVKESKAYF 196 |
| Debaryomyces hansenii CBS767 | Query 153 DETLRLVQAFQYTDEHGEVCPAGWKPGGDT#IKPNVEDSKEYFSKNN 198 +|+||||+|||+|+++|||||| |+|| +|#||| | ||||| | | Sbjct 150 EESLRLVEAFQFTEKYGEVCPANWQPGSET#IKPEVSSSKEYFGKVN 195 |
| Pichia guilliermondii ATCC 6260 | Query 153 DETLRLVQAFQYTDEHGEVCPAGWKPGGDT#IKPNVEDSKEYFSKNN 198 +|+||||+|||+|+++|||||| |+|| +|#||| |+ +|||| | | Sbjct 150 EESLRLVEAFQFTEKYGEVCPANWQPGSET#IKPGVDSAKEYFGKVN 195 |
| Paramecium tetraurelia | Query 153 DETLRLVQAFQYTDEHGEVCPAGWKPGGDT#IKPNVEDSKEYFSKN 197 ||||||+||||||| ||||||| |||| |#| |+ + |||+|+ Sbjct 184 DETLRLIQAFQYTDTHGEVCPANWKPGQRT#IVPDQDKKVEYFAKS 228 |
| Toxoptera citricida | Query 153 DETLRLVQAFQYTDEHGEVCPAGWKPGGDT#IKPNVEDSKEYF 194 |||||||||||||||||||||| |||| |#| |+ ||+|| Sbjct 150 DETLRLVQAFQYTDEHGEVCPANWKPGSKT#INPS--KSKDYF 189 |
| Apis mellifera ligustica | Query 153 DETLRLVQAFQYTDEHGEVCPAGWKPGGDT#IKPNVEDSKEYFSKNN 198 ||||||++|||+ ++||||||| |+| |#|||| +|||+|| | Sbjct 197 DETLRLIKAFQFVEKHGEVCPANWQPDSKT#IKPNPKDSKQYFESVN 242 |
| Trypanosoma cruzi strain CL Brener | Query 153 DETLRLVQAFQYTDEHGEVCPAGWKPGGDT#IKPNVEDSKEYF 194 || ||||+|||+ +|||||||| |||| |#+||+ | ||||| Sbjct 154 DEALRLVKAFQFVEEHGEVCPANWKPGDKT#MKPDPEKSKEYF 195 |
| Glossina morsitans morsitans | Query 153 DETLRLVQAFQYTDEHGEVCPAGWKPGGDT#IKPNVEDSKEYFSKNN 198 |||||| ||||| | |||||||| ||| ||#| | + +||+||| Sbjct 201 DETLRLXQAFQYXDXHGEVCPAGXKPGADT#IVLNPREKAKYFAKNN 246 |
| Schistosoma mansoni | Query 153 DETLRLVQAFQYTDEHGEVCPAGWKPGGDT#IKPNVEDSKEYFSKNN 198 || ||||+||||||++|||||| |+| | |#|||+++ |||| | | Sbjct 174 DEVLRLVRAFQYTDKYGEVCPADWQPKGPT#IKPDLKKYKEYFHKVN 219 |
| Pichia stipitis CBS 6054 | Query 153 DETLRLVQAFQYTDEHGEVCPAGWKPGGDT#IKPNVEDSKEYFSKNN 198 +|+|||++|||+|+++|||||| | || +|#||| | ||||| | | Sbjct 150 EESLRLLEAFQFTEKYGEVCPANWTPGAET#IKPEVSSSKEYFGKVN 195 |
| Schistosoma japonicum | Query 153 DETLRLVQAFQYTDEHGEVCPAGWKPGGDT#IKPNVEDSKEYFSK 196 || ||||+|||+||+||||||| |+| | |#|||+++ |||| | Sbjct 175 DEVLRLVRAFQFTDKHGEVCPADWQPKGPT#IKPDLKQYKEYFHK 218 |
| Lodderomyces elongisporus NRRL YB-4239 | Query 153 DETLRLVQAFQYTDEHGEVCPAGWKPGGDT#IKPNVEDSKEYFSKNN 198 +|+|||++|||+|+++|||||| |+|| +|#|| |||||||| | Sbjct 150 EESLRLLEAFQFTEKYGEVCPANWQPGSET#IKATPNDSKEYFSKVN 195 |
| Candida albicans SC5314 | Query 153 DETLRLVQAFQYTDEHGEVCPAGWKPGGDT#IKPNVEDSKEYFSKNN 198 +|+|||++|||+|+++|||||| | || +|#|||+ | |||||+| | Sbjct 150 EESLRLLEAFQFTEKYGEVCPANWHPGDET#IKPSPEASKEYFNKVN 195 |
| Pongo pygmaeus | Query 153 DETLRLVQAFQYTDEHGEVCPAGWKPGGDT#IKPNVEDSKEYFSKNN 198 +||||||+|||| + ||||||| | | |#|||| ||||| | | Sbjct 210 EETLRLVKAFQYVETHGEVCPANWTPDSPT#IKPNPAASKEYFQKVN 255 |
| Amoeba proteus | Query 153 DETLRLVQAFQYTDEHGEVCPAGWKPGGDT#IKPNVEDSKEYFSK 196 +| ||+||||+||+||||||| |+|| |#|||| | ||||+ Sbjct 129 EEFKRLIQAFQFTDKHGEVCPASWRPGAAT#IKPNPVDKLEYFSQ 172 |
| Litomosoides sigmodontis | Query 153 DETLRLVQAFQYTDEHGEVCPAGWKPGGDT#IKPNVEDSK 191 ||||||+||||+ |+|||+||| |+|| +|#||| |++|| Sbjct 155 DETLRLIQAFQFVDKHGELCPANWQPGSET#IKPGVKESK 193 |
| Maconellicoccus hirsutus | Query 153 DETLRLVQAFQYTDEHGEVCPAGWKPGGDT#IKPNVEDSKEYF 194 |||||||||||+||+||||||| |||| +#+| + + ++||| Sbjct 150 DETLRLVQAFQFTDKHGEVCPANWKPGSKS#MKADPKGAQEYF 191 |
| Taiwanofungus camphoratus | Query 153 DETLRLVQAFQYTDEHGEVCPAGWKPGGDT#IKPNVEDSKEYFS 195 |||+||++|||+|||||||||| | || |#|| + + | |||| Sbjct 151 DETIRLIKAFQFTDEHGEVCPANWTEGGKT#IKADPKGSLEYFS 193 |
| Yarrowia lipolytica | Query 153 DETLRLVQAFQYTDEHGEVCPAGWKPGGDT#IKPNVEDSKEYFSKNN 198 +|||||+ |||+|++||||||| |+ | ||#|| + ++|||| | | Sbjct 150 EETLRLIDAFQFTEKHGEVCPANWQKGSDT#IKADPVNAKEYFEKAN 195 |
| Trypanosoma cruzi | Query 153 DETLRLVQAFQYTDEHGEVCPAGWKPGGDT#IKPNVEDSKEYF 194 || ||||+|||+ ++||||||| |||| #+||+ | ||||| Sbjct 154 DEALRLVKAFQFVEKHGEVCPANWKPGDKA#MKPDPEKSKEYF 195 |
| Trypanosoma brucei TREU927 | Query 153 DETLRLVQAFQYTDEHGEVCPAGWKPGGDT#IKPNVEDSKEYFSKNN 198 |||||||+|||+ ++||||||| |||| |#+| + |++||| | Sbjct 154 DETLRLVKAFQFVEKHGEVCPANWKPGSKT#MKADPNGSQDYFSSMN 199 |
| Ostreococcus lucimarinus CCE9901 | Query 153 DETLRLVQAFQYTDEHGEVCPAGWKPGGDT#IKPNVEDSKEYFSK 196 |||||||+||||| |||||||||| || |#+ + | || || + Sbjct 149 DETLRLVRAFQYTAEHGEVCPAGWTPGAPT#MIDDPEKSKTYFEQ 192 |
| Saccharomyces cerevisiae | Query 153 DETLRLVQAFQYTDEHGEVCPAGWKPGGDT#IKPNVEDSKEYFSKNN 198 || ||||+|||+||++| | | | || |#||| |||||||| | Sbjct 150 DEALRLVEAFQWTDKNGTVLPCNWTPGAAT#IKPTVEDSKEYFEAAN 195 |
| Phaeosphaeria nodorum SN15 | Query 153 DETLRLVQAFQYTDEHGEVCPAGWKPGGDT#IKPNVEDSKEYFSK 196 ||||||+ |||+||++|||||| | || +|#|| | +||| | Sbjct 159 DETLRLIDAFQFTDKYGEVCPANWNPGDET#IKATPEGNKEYLGK 202 |
| Gibberella zeae PH-1 | Query 153 DETLRLVQAFQYTDEHGEVCPAGWKPGGDT#IKPNVEDSKEYFS 195 +||+|||+|||+|||+||||||||+ || |#+| + + | |||| Sbjct 153 EETIRLVKAFQFTDEYGEVCPAGWQEGGKT#MKADPKGSLEYFS 195 |
| Drosophila yakuba | Query 153 DETLRLVQAFQYTDEHGEVCPAGWKPGGDT#IKPNVEDSKEYF 194 +|||||||||||||++|||||| |||| |#+ + ||||| Sbjct 149 EETLRLVQAFQYTDKYGEVCPANWKPGQKT#MVADPTKSKEYF 190 |
| Ostreococcus tauri | Query 153 DETLRLVQAFQYTDEHGEVCPAGWKPGGDT#IKPNVEDSKEYF 194 ||||||++| ||| |||||||||| || |#+ + | ||||| Sbjct 7 DETLRLLRAIQYTKEHGEVCPAGWTPGDPT#MVGDPEKSKEYF 48 |
| Candida glabrata | Query 153 DETLRLVQAFQYTDEHGEVCPAGWKPGGDT#IKPNVEDSKEYFSKNN 198 +|+||||+ ||+||++| | | | || |#||| |||||||| + | Sbjct 150 EESLRLVEGFQWTDKNGTVLPCNWTPGSAT#IKPTVEDSKEYFKEAN 195 |
| Taenia solium | Query 153 DETLRLVQAFQYTDEHGEVCPAGWKPGGDT#IKPNVEDSKEYFS 195 || |||+ |||+||+||||||| |+|| # ||| | | + | Sbjct 153 DEALRLLDAFQFTDKHGEVCPANWRPGSKA#FKPNAGDLKSFMS 195 |
| Moniliophthora perniciosa | Query 153 DETLRLVQAFQYTDEHGEVCPAGWKPGGDT#IKPNVEDSKEYF 194 +||+|||+|||+||+||||||| | || |#|| + + | ||| Sbjct 151 EETIRLVKAFQFTDKHGEVCPANWSEGGKT#IKADPKSSLEYF 192 |
| Entamoeba moshkovskii | Query 153 DETLRLVQAFQYTDEHGEVCPAGWKPGGDT#IKPNVEDSKEYFSKN 197 |||+|+|+| |+||+|| ||| |||| ||#|+|+ + |+| | + Sbjct 173 DETIRIVKAIQFTDQHGAVCPLNWKPGNDT#IEPSHDGIKKYLSSH 217 |
| Echinococcus granulosus | Query 153 DETLRLVQAFQYTDEHGEVCPAGWKPGGDT#IKPNVEDSKEYFS 195 || |||+ |||+||+||||||| |+|| |# ||+ | | + | Sbjct 150 DEALRLLDAFQFTDKHGEVCPANWQPGSKT#FKPSAGDLKSFMS 192 |
| Echinococcus multilocularis | Query 153 DETLRLVQAFQYTDEHGEVCPAGWKPGGDT#IKPNVEDSKEYFS 195 || |||+ |||+||+||||||| | || |# ||+ | | + | Sbjct 150 DEALRLLDAFQFTDKHGEVCPANWHPGSKT#FKPSAGDLKSFMS 192 |
| Tetrahymena thermophila SB210 | Query 153 DETLRLVQAFQYTDEHGEVCPAGWKPGGDT#IKPN--VEDSKEYFSK 196 || ||||+|||+|||||||||| |+||| #+ || | ||++ | Sbjct 176 DEYLRLVEAFQFTDEHGEVCPAKWRPGGKG#MVPNHQSEKLKEFWEK 221 |
| Phanerochaete chrysosporium | Query 153 DETLRLVQAFQYTDEHGEVCPAGWKPGGDT#IKPNVEDSKEYFSKNN 198 |||+||++|||+ +++|||||| || || |#+| + + | |||| | Sbjct 151 DETIRLIKAFQFVEKYGEVCPANWKEGGKT#MKADPKGSLEYFSTVN 196 |
| Trichomonas vaginalis G3 | Query 153 DETLRLVQAFQYTDEHGEVCPAGWKPGGD-T#IKPNVEDSKEYFSKNN 198 || ||||+|+|+ +||||||| | || |#|||| + ||||| | | Sbjct 149 DEILRLVKAYQFAAKHGEVCPAQWHGEGDLT#IKPNPKASKEYFGKAN 195 |
| Oryza sativa (japonica cultivar-group) | Query 153 DETLRLVQAFQYTDEH-GEVCPAGWKPGGDT#IKPNVEDSKEYFS 195 ||||| +|| || |+ |||||||||| +#+||+ +||||||+ Sbjct 122 DETLRTLQALQYVQENPDEVCPAGWKPGEKS#MKPDPKDSKEYFA 165 |
| Oryza sativa (indica cultivar-group) | Query 153 DETLRLVQAFQYTDEH-GEVCPAGWKPGGDT#IKPNVEDSKEYFS 195 ||||| +|| || |+ |||||||||| +#+||+ +||||||+ Sbjct 118 DETLRTLQALQYVQENPDEVCPAGWKPGEKS#MKPDPKDSKEYFA 161 |
| Nitrosococcus oceani ATCC 19707 | Query 153 DETLRLVQAFQYTDEHGEVCPAGWKPGGDT#IKPNVEDSKEYFSKN 197 +| ||+| | |+|+||||||||||+ | + #|+|+ | || ||+ Sbjct 151 EEMLRVVDALQFTEEHGEVCPAGWRKGEEA#IRPDAEGVAEYLSKH 195 |
| Spinacia oleracea | Query 153 DETLRLVQAFQYTDEHGEVCPAGWKPGGDT#IKPNVEDSKEYFS 195 |||+| +|| ||| |||||||||| +#+||+ + |||||| Sbjct 221 DETMRTLQALQYTGNPDEVCPAGWKPGEKS#MKPDPKLSKEYFS 263 |
| Ashbya gossypii ATCC 10895 | Query 153 DETLRLVQAFQYTDEHGEVCPAGWKPGGDT#IKPNVEDSKEYFSK 196 || ||||+ ||+||++| | | | || |#|||+| ||||||+ Sbjct 150 DEALRLVEGFQWTDKNGTVLPCNWTPGAAT#IKPDVAASKEYFSE 193 |
| Kluyveromyces lactis | Query 153 DETLRLVQAFQYTDEHGEVCPAGWKPGGDT#IKPNVEDSKEYFSKNN 198 +| ||||+ ||+||++| | | | || |#||| |+ |||||| | Sbjct 150 EEALRLVEGFQWTDKNGTVLPCNWTPGAAT#IKPEVDASKEYFSSVN 195 |
| Brugia malayi | Query 153 DETLRLVQAFQYTDEHGEVCPAGWKPGGDT#IKPNVEDSKEYFSK 196 || | ++|||+ ++||||||| | |#||| +++||||| | Sbjct 181 DEAFRTLKAFQFVEKHGEVCPANWSDDKPT#IKPGIKESKEYFKK 224 |
| Leptospira borgpetersenii serovar Hardjo-bovis L550 | Query 153 DETLRLVQAFQYTDEHGEVCPAGWKPGGDT#IKPNVEDSKEYFSKNN 198 || +||++|||+ ++||||||| | | |#+| + | ||+||| | Sbjct 148 DEAIRLIKAFQFVEKHGEVCPANWDEGKKT#MKADPEKSKDYFSAVN 193 |
| Cryptococcus neoformans var. grubii | Query 153 DETLRLVQAFQYTDEHGEVCPAGWKPGGDT#IKPNVEDSKEYFSK 196 +||+|+++|||+||||||||||||+ | ||#| + + |||| Sbjct 155 EETIRVIKAFQFTDEHGEVCPAGWEEGKDT#IDTSAPSA--YFSK 196 |
| Cryptococcus neoformans var. neoformans JEC21 | Query 153 DETLRLVQAFQYTDEHGEVCPAGWKPGGDT#IKPNVEDSKEYFSK 196 +||+|+++|||+||||||||||||+ | ||#| + + |||| Sbjct 155 EETIRVIKAFQFTDEHGEVCPAGWEEGKDT#IDTSAPSA--YFSK 196 |
| Hordeum vulgare subsp. vulgare | Query 153 DETLRLVQAFQYTDEHGEVCPAGWKPGGDT#IKPNVEDSKEYFS 195 ||||| +|| || + |||||||||| +#+||+ + |||||+ Sbjct 166 DETLRTLQALQYVKKPDEVCPAGWKPGEKS#MKPDPKGSKEYFA 208 |
| Prochlorococcus marinus str. NATL2A | Query 153 DETLRLVQAFQYTDEH-GEVCPAGWKPGGDT#IKPNVEDSKEYFS 195 |||||++||+|| + | ||||||| || |#+| + + |||||| Sbjct 153 DETLRVLQAYQYVESHPDEVCPAGWTPGDKT#MKEDPKGSKEYFS 196 |
| Chlorobium ferrooxidans DSM 13031 | Query 153 DETLRLVQAFQYTDEHGEVCPAGWKPGGDT#IKPNVEDSKEYFSK 196 || |||| | |+|+|||||||| | | |#+|| + ||+| + Sbjct 152 DEVLRLVDALQFTEEHGEVCPANWNKGDKT#MKPTDDGLKEFFKE 195 |
| Entamoeba histolytica | Query 153 DETLRLVQAFQYTDEHGEVCPAGWKPGGDT#IKPNVEDSKEYFS 195 +||+|+|+| |++|||| ||| |||| ||#|+| + |+| + Sbjct 187 EETIRIVKAIQFSDEHGAVCPLNWKPGKDT#IEPTPDGIKKYLT 229 |
[Site 5] PNVEDSKEYF194-SKNN
Phe194 Ser
|
|||||||||
| P10 | P9 | P8 | P7 | P6 | P5 | P4 | P3 | P2 | P1 |
|---|---|---|---|---|---|---|---|---|---|
| Pro185 | Asn186 | Val187 | Glu188 | Asp189 | Ser190 | Lys191 | Glu192 | Tyr193 | Phe194 |
|
|||||||||
| P1' | P2' | P3' | P4' | P5' | P6' | P7' | P8' | P9' | P10' |
| Ser195 | Lys196 | Asn197 | Asn198 | - | - | - | - | - | - |
Sequence conservation (by blast) Sequence conservation (by blast)
| Reference peptide (cleaved bond±30 residues) |
|---|
| TDEHGEVCPAGWKPGGDTIKPNVEDSKEYFSKNN |
Summary
| # | organism | max score | hits | top seq |
|---|---|---|---|---|
| 1 | N/A | 80.10 | 17 | - |
| 2 | Mus musculus | 74.70 | 16 | Prdx2 protein |
| 3 | Homo sapiens | 74.70 | 15 | peroxiredoxin 2 isoform a |
| 4 | synthetic construct | 74.70 | 8 | peroxiredoxin 2 |
| 5 | Macaca mulatta | 74.70 | 8 | PREDICTED: peroxiredoxin 2 isoform 2 |
| 6 | Rattus norvegicus | 74.70 | 7 | peroxiredoxin 2 |
| 7 | Cricetulus griseus | 74.70 | 2 | PRDX2_CRIGR Peroxiredoxin-2 gb |
| 8 | Bos taurus | 72.40 | 5 | peroxiredoxin 2 |
| 9 | Xenopus tropicalis | 66.60 | 4 | peroxiredoxin 2 |
| 10 | Branchiostoma belcheri tsingtaunese | 66.20 | 1 | thioredoxin peroxidase |
| 11 | Canis familiaris | 65.90 | 10 | PREDICTED: similar to peroxiredoxin 1 |
| 12 | Gallus gallus | 65.90 | 6 | PREDICTED: similar to natural killer cell enhancin |
| 13 | Macaca fascicularis | 65.90 | 4 | unnamed protein product |
| 14 | Pan troglodytes | 65.90 | 4 | PREDICTED: similar to proliferation associated gen |
| 15 | Myotis lucifugus | 65.90 | 1 | PRDX1_MYOLU Peroxiredoxin-1 gb |
| 16 | Monodelphis domestica | 65.50 | 3 | PREDICTED: similar to proliferation associated gen |
| 17 | Ciona intestinalis | 65.50 | 1 | peroxiredoxin-like |
| 18 | Tetraodon nigroviridis | 64.70 | 3 | unnamed protein product |
| 19 | Ictalurus punctatus | 64.70 | 1 | natural killer cell enhancing factor |
| 20 | Gekko japonicus | 64.70 | 1 | PRDX1_GECJA Peroxiredoxin-1 gb |
| 21 | Cyprinus carpio | 64.70 | 1 | natural killer cell enhancing factor |
| 22 | Danio rerio | 64.30 | 5 | hypothetical protein LOC541344 |
| 23 | Spermophilus tridecemlineatus | 63.50 | 1 | peroxiredoxin 2 |
| 24 | Paralichthys olivaceus | 63.20 | 1 | natural killer enhancing factor |
| 25 | Oncorhynchus mykiss | 63.20 | 1 | AF250193_1 natural killer cell enhancement factor |
| 26 | Xenopus laevis | 62.80 | 7 | MGC83078 protein |
| 27 | Ixodes scapularis | 62.80 | 2 | thioredoxin peroxidase |
| 28 | Drosophila melanogaster | 61.20 | 2 | thioredoxin peroxidase 2 CG1274-PA, isoform A |
| 29 | Ostertagia ostertagi | 61.20 | 1 | thioredoxin peroxidase |
| 30 | Cynops pyrrhogaster | 61.20 | 1 | TDX_CYNPY Peroxiredoxin (Thioredoxin peroxidase) ( |
| 31 | Aedes aegypti | 60.10 | 2 | peroxiredoxins, prx-1, prx-2, prx-3 |
| 32 | Scophthalmus maximus | 60.10 | 1 | natural killer enhancing factor |
| 33 | Haemonchus contortus | 59.70 | 1 | peroxiredoxin |
| 34 | Strongylocentrotus purpuratus | 59.30 | 3 | PREDICTED: similar to thioredoxin peroxidase |
| 35 | Drosophila pseudoobscura | 59.30 | 3 | GA11781-PA |
| 36 | Anopheles gambiae str. PEST | 59.30 | 3 | ENSANGP00000010951 |
| 37 | Ascaris suum | 58.50 | 1 | PRDX_ASCSU Peroxiredoxin (AsPrx) (Thioredoxin pero |
| 38 | Caenorhabditis elegans | 57.80 | 2 | PeRoxireDoXin family member (prdx-2) |
| 39 | Onchocerca volvulus | 57.40 | 2 | thioredoxin peroxidase |
| 40 | Onchocerca ochengi | 57.40 | 1 | peroxidoxin-2 |
| 41 | Caenorhabditis briggsae | 57.00 | 2 | Hypothetical protein CBG02380 |
| 42 | Bombyx mori | 56.60 | 2 | thioredoxin peroxidase |
| 43 | Apis mellifera | 56.20 | 2 | PREDICTED: similar to thioredoxin peroxidase 1 CG1 |
| 44 | Artemia franciscana | 56.20 | 1 | thioredoxin peroxidase |
| 45 | Debaryomyces hansenii CBS767 | 55.50 | 1 | hypothetical protein DEHA0G11154g |
| 46 | Pichia guilliermondii ATCC 6260 | 55.10 | 1 | peroxiredoxin TSA1 |
| 47 | Pichia stipitis CBS 6054 | 54.70 | 1 | Peroxiredoxin TSA1 |
| 48 | Tribolium castaneum | 54.30 | 4 | PREDICTED: similar to CG1633-PA, isoform A |
| 49 | Amoeba proteus | 54.30 | 1 | peroxiredoxin |
| 50 | Biomphalaria glabrata | 54.30 | 1 | thioredoxin peroxidase BgTPx |
| 51 | Lodderomyces elongisporus NRRL YB-4239 | 53.90 | 1 | peroxiredoxin TSA1 |
| 52 | Candida albicans SC5314 | 53.90 | 1 | putative thioredoxin peroxidase |
| 53 | Dirofilaria immitis | 53.10 | 2 | thioredoxin peroxidase |
| 54 | Trypanosoma cruzi strain CL Brener | 52.80 | 4 | tryparedoxin peroxidase |
| 55 | Schistosoma japonicum | 52.80 | 1 | SJCHGC01281 protein |
| 56 | Acanthocheilonema viteae | 52.40 | 1 | thiredoxin peroxidase |
| 57 | Globodera rostochiensis | 52.40 | 1 | peroxiredoxin |
| 58 | Apis mellifera ligustica | 51.60 | 1 | thioredoxin peroxidase |
| 59 | Schistosoma mansoni | 51.20 | 1 | AF301001_1 thioredoxin peroxidase 3 |
| 60 | Glossina morsitans morsitans | 50.40 | 3 | putative thioredoxin peroxidase 3 |
| 61 | Yarrowia lipolytica | 50.10 | 1 | hypothetical protein |
| 62 | Paramecium tetraurelia | 49.70 | 4 | hypothetical protein |
| 63 | Candida glabrata | 49.70 | 2 | unnamed protein product |
| 64 | Trypanosoma cruzi | 49.30 | 1 | AF320771_1 tryparedoxin peroxidase |
| 65 | Nitrosococcus oceani ATCC 19707 | 49.30 | 1 | Alkyl hydroperoxide reductase/ Thiol specific anti |
| 66 | Pongo pygmaeus | 49.30 | 1 | PRDX3_PONPY Thioredoxin-dependent peroxide reducta |
| 67 | Saccharomyces cerevisiae | 48.90 | 1 | Tsa1p |
| 68 | Taiwanofungus camphoratus | 48.90 | 1 | peroxiredoxin |
| 69 | Toxoptera citricida | 48.50 | 1 | putative cytosolic thioredoxin peroxidase |
| 70 | Gibberella zeae PH-1 | 48.50 | 1 | hypothetical protein FG03180.1 |
| 71 | Entamoeba moshkovskii | 47.80 | 3 | peroxiredoxin |
| 72 | Fasciola hepatica | 47.80 | 2 | thiol-specific antioxidant protein |
| 73 | Phaeosphaeria nodorum SN15 | 47.80 | 1 | hypothetical protein SNOG_00334 |
| 74 | Taenia solium | 47.80 | 1 | 2-Cys peroxiredoxin |
| 75 | Echinococcus granulosus | 47.40 | 2 | TDX_ECHGR Thioredoxin peroxidase (Peroxiredoxin) ( |
| 76 | Litomosoides sigmodontis | 47.40 | 1 | AF105258_1 peroxidoxin-2 |
| 77 | Ostreococcus tauri | 47.40 | 1 | thioredoxin I (ISS) |
| 78 | Brugia malayi | 47.40 | 1 | TDX1_BRUMA Thioredoxin peroxidase 1 (Peroxiredoxin |
| 79 | Chlamydomonas reinhardtii | 47.00 | 2 | peroxiredoxin |
| 80 | Trypanosoma brucei TREU927 | 47.00 | 1 | tryparedoxin peroxidase |
| 81 | Oryza sativa (japonica cultivar-group) | 46.60 | 4 | OJ991214_12.15 |
| 82 | Oryza sativa (indica cultivar-group) | 46.60 | 2 | hypothetical protein OsI_015300 |
| 83 | Echinococcus multilocularis | 46.60 | 1 | thioredoxin peroxidase |
| 84 | Moniliophthora perniciosa | 46.60 | 1 | cys 2 peroxiredoxin |
| 85 | Trichomonas vaginalis G3 | 46.20 | 3 | thioredoxin peroxidase |
| 86 | Maconellicoccus hirsutus | 46.20 | 1 | putative cytosolic thioredoxin peroxidase |
| 87 | Kluyveromyces lactis | 46.20 | 1 | unnamed protein product |
| 88 | Campylobacter curvus 525.92 | 45.80 | 1 | hypothetical protein Ccur5_02001540 |
| 89 | Chlamydomonas incerta | 45.80 | 1 | chloroplast thioredoxin peroxidase |
| 90 | Riccia fluitans | 45.40 | 1 | 2-Cys-peroxiredoxin |
| 91 | Ostreococcus lucimarinus CCE9901 | 45.40 | 1 | predicted protein |
| 92 | Entamoeba histolytica HM-1:IMSS | 45.10 | 7 | peroxiredoxin |
| 93 | Entamoeba histolytica | 45.10 | 3 | 30 kDa type I collagen binding protein |
| 94 | Nicotiana tabacum | 45.10 | 1 | thioredoxin peroxidase |
| 95 | Tetrahymena thermophila SB210 | 44.70 | 2 | AhpC/TSA family protein |
Top-ranked sequences
| organism | matching |
|---|---|
| N/A | Query 165 TDEHGEVCPAGWKPGGDTIKPNVEDSKEYF#SKNN 198 ||||||||||||||||||||||||||||||#|||| Query 165 TDEHGEVCPAGWKPGGDTIKPNVEDSKEYF#SKNN 198 |
| Mus musculus | Query 165 TDEHGEVCPAGWKPGGDTIKPNVEDSKEYF#SKNN 198 ||||||||||||||| |||||||+||||||#||+| Sbjct 165 TDEHGEVCPAGWKPGSDTIKPNVDDSKEYF#SKHN 198 |
| Homo sapiens | Query 165 TDEHGEVCPAGWKPGGDTIKPNVEDSKEYF#SKNN 198 ||||||||||||||| |||||||+||||||#||+| Sbjct 165 TDEHGEVCPAGWKPGSDTIKPNVDDSKEYF#SKHN 198 |
| synthetic construct | Query 165 TDEHGEVCPAGWKPGGDTIKPNVEDSKEYF#SKNN 198 ||||||||||||||| |||||||+||||||#||+| Sbjct 165 TDEHGEVCPAGWKPGSDTIKPNVDDSKEYF#SKHN 198 |
| Macaca mulatta | Query 165 TDEHGEVCPAGWKPGGDTIKPNVEDSKEYF#SKNN 198 ||||||||||||||| |||||||+||||||#||+| Sbjct 115 TDEHGEVCPAGWKPGSDTIKPNVDDSKEYF#SKHN 148 |
| Rattus norvegicus | Query 165 TDEHGEVCPAGWKPGGDTIKPNVEDSKEYF#SKNN 198 ||||||||||||||| |||||||+||||||#||+| Sbjct 165 TDEHGEVCPAGWKPGSDTIKPNVDDSKEYF#SKHN 198 |
| Cricetulus griseus | Query 165 TDEHGEVCPAGWKPGGDTIKPNVEDSKEYF#SKNN 198 ||||||||||||||| |||||||+||||||#||+| Sbjct 165 TDEHGEVCPAGWKPGSDTIKPNVDDSKEYF#SKHN 198 |
| Bos taurus | Query 165 TDEHGEVCPAGWKPGGDTIKPNVEDSKEYF#SKNN 198 |||||||||||| || |||||||+||||||#||+| Sbjct 166 TDEHGEVCPAGWTPGSDTIKPNVDDSKEYF#SKHN 199 |
| Xenopus tropicalis | Query 165 TDEHGEVCPAGWKPGGDTIKPNVEDSKEYF#SK 196 ||+|||||||||||| ||||||+||||+|#|| Sbjct 173 TDQHGEVCPAGWKPGSSTIKPNVKDSKEFF#SK 204 |
| Branchiostoma belcheri tsingtaunese | Query 165 TDEHGEVCPAGWKPGGDTIKPNVEDSKEYF#SK 196 ||+|||||||||||| |||||+|++|||||#|| Sbjct 166 TDKHGEVCPAGWKPGADTIKPDVKNSKEYF#SK 197 |
| Canis familiaris | Query 165 TDEHGEVCPAGWKPGGDTIKPNVEDSKEYF#SK 196 ||+|||||||||||| |||||+|+ |||||#|| Sbjct 166 TDKHGEVCPAGWKPGSDTIKPDVQKSKEYF#SK 197 |
| Gallus gallus | Query 165 TDEHGEVCPAGWKPGGDTIKPNVEDSKEYF#SK 196 ||+|||||||||||| |||||+|+ |||||#|| Sbjct 166 TDKHGEVCPAGWKPGSDTIKPDVQKSKEYF#SK 197 |
| Macaca fascicularis | Query 165 TDEHGEVCPAGWKPGGDTIKPNVEDSKEYF#SK 196 ||+|||||||||||| |||||+|+ |||||#|| Sbjct 162 TDKHGEVCPAGWKPGSDTIKPDVQKSKEYF#SK 193 |
| Pan troglodytes | Query 165 TDEHGEVCPAGWKPGGDTIKPNVEDSKEYF#SK 196 ||+|||||||||||| |||||+|+ |||||#|| Sbjct 115 TDKHGEVCPAGWKPGSDTIKPDVQKSKEYF#SK 146 |
| Myotis lucifugus | Query 165 TDEHGEVCPAGWKPGGDTIKPNVEDSKEYF#SK 196 ||+|||||||||||| |||||+|+ |||||#|| Sbjct 166 TDKHGEVCPAGWKPGSDTIKPDVQKSKEYF#SK 197 |
| Monodelphis domestica | Query 165 TDEHGEVCPAGWKPGGDTIKPNVEDSKEYF#SKNN 198 ||++||||||||||| |||||+|+ |||||#|| | Sbjct 166 TDKYGEVCPAGWKPGSDTIKPDVKGSKEYF#SKQN 199 |
| Ciona intestinalis | Query 165 TDEHGEVCPAGWKPGGDTIKPNVEDSKEYF#SK 196 ||+|||||||||||| |||||+|+||++||#|| Sbjct 165 TDQHGEVCPAGWKPGDDTIKPDVQDSQKYF#SK 196 |
| Tetraodon nigroviridis | Query 165 TDEHGEVCPAGWKPGGDTIKPNVEDSKEYF#SKN 197 ||+|||||||||||| |||||+|+ |||+|#||+ Sbjct 166 TDKHGEVCPAGWKPGSDTIKPDVQKSKEFF#SKH 198 |
| Ictalurus punctatus | Query 165 TDEHGEVCPAGWKPGGDTIKPNVEDSKEYF#SKNN 198 ||+|||||||||||| |||||+|+ ||++|#|| | Sbjct 166 TDKHGEVCPAGWKPGKDTIKPDVQKSKDFF#SKQN 199 |
| Gekko japonicus | Query 165 TDEHGEVCPAGWKPGGDTIKPNVEDSKEYF#SKN 197 ||+|||||||||+|| |||||+|+ |||||#||+ Sbjct 166 TDKHGEVCPAGWQPGSDTIKPDVQKSKEYF#SKH 198 |
| Cyprinus carpio | Query 165 TDEHGEVCPAGWKPGGDTIKPNVEDSKEYF#SKNN 198 ||+|||||||||||| |||||+|+ ||+||#|| + Sbjct 166 TDKHGEVCPAGWKPGKDTIKPDVQQSKDYF#SKQH 199 |
| Danio rerio | Query 165 TDEHGEVCPAGWKPGGDTIKPNVEDSKEYF#SKNN 198 ||+|||||||||||| |||||+| ||++|#|| | Sbjct 166 TDKHGEVCPAGWKPGKDTIKPDVNQSKDFF#SKQN 199 |
| Spermophilus tridecemlineatus | Query 165 TDEHGEVCPAGWKPGGDTIKPNVEDSKE 192 ||||||||||||||| |||||||+|||| Sbjct 74 TDEHGEVCPAGWKPGSDTIKPNVDDSKE 101 |
| Paralichthys olivaceus | Query 165 TDEHGEVCPAGWKPGGDTIKPNVEDSKEYF#SK 196 ||+|||||||||||| |||||+|+ ||++|#|| Sbjct 166 TDKHGEVCPAGWKPGSDTIKPDVQKSKDFF#SK 197 |
| Oncorhynchus mykiss | Query 165 TDEHGEVCPAGWKPGGDTIKPNVEDSKEYF#SK 196 ||+|||||||||||| |||||+|+ ||++|#|| Sbjct 166 TDKHGEVCPAGWKPGSDTIKPDVQKSKDFF#SK 197 |
| Xenopus laevis | Query 165 TDEHGEVCPAGWKPGGDTIKPNVEDSKEYF#SK 196 || |||||||||||| |||||+||||+|#|| Sbjct 169 TDVHGEVCPAGWKPGSSIIKPNVKDSKEFF#SK 200 |
| Ixodes scapularis | Query 165 TDEHGEVCPAGWKPGGDTIKPNVEDSKEYF#SK 196 ||+|||||||||||||||| || || +||#|| Sbjct 216 TDKHGEVCPAGWKPGGDTIIPNPEDKLKYF#SK 247 |
| Drosophila melanogaster | Query 165 TDEHGEVCPAGWKPGGDTIKPNVEDSKEYF#SKNN 198 || |||||||||+|| ||| || |+ +||#+||| Sbjct 209 TDTHGEVCPAGWRPGADTIVPNPEEKTKYF#AKNN 242 |
| Ostertagia ostertagi | Query 166 DEHGEVCPAGWKPGGDTIKPNVEDSKEYF#SKNN 198 |+||||||||| || |||| |+||||||#|| | Sbjct 161 DKHGEVCPAGWTPGKATIKPGVKDSKEYF#SKAN 193 |
| Cynops pyrrhogaster | Query 165 TDEHGEVCPAGWKPGGDTIKPNVEDSKEYF#SK 196 ||+ ||||||||||| |||||++ |||||#|| Sbjct 166 TDKFGEVCPAGWKPGSDTIKPDISKSKEYF#SK 197 |
| Aedes aegypti | Query 165 TDEHGEVCPAGWKPGGDTIKPNVEDSKEYF#SKNN 198 ||+|||||||||||| ||| || |+ +||# ||+ Sbjct 222 TDKHGEVCPAGWKPGQDTIVPNPEEKMKYF#EKNH 255 |
| Scophthalmus maximus | Query 165 TDEHGEVCPAGWKPGGDTIKPNVEDSKEYF#SK 196 ||+|||||||||||| ||| |+|| || +|#|| Sbjct 165 TDKHGEVCPAGWKPGSDTIIPDVEKSKAFF#SK 196 |
| Haemonchus contortus | Query 166 DEHGEVCPAGWKPGGDTIKPNVEDSKEYF#SKNN 198 |+||||||||| || +|||| |++|+|||#|| | Sbjct 164 DKHGEVCPAGWTPGKETIKPRVKESQEYF#SKAN 196 |
| Strongylocentrotus purpuratus | Query 165 TDEHGEVCPAGWKPGGDTIKPNVEDSKEYF#SK 196 ||+ ||||||||||| ||||| |++|||+|# | Sbjct 165 TDKFGEVCPAGWKPGDDTIKPGVKESKEFF#GK 196 |
| Drosophila pseudoobscura | Query 165 TDEHGEVCPAGWKPGGDTIKPNVEDSKEYF#SKNN 198 || |||||||||+|| ||| |+ |+ +||#+||| Sbjct 210 TDTHGEVCPAGWRPGADTIVPDPEEKTKYF#AKNN 243 |
| Anopheles gambiae str. PEST | Query 165 TDEHGEVCPAGWKPGGDTIKPNVEDSKEYF#SKNN 198 ||+|||||||||||| ||| || |+ +||# ||+ Sbjct 217 TDKHGEVCPAGWKPGQDTIVPNPEEKIKYF#EKNH 250 |
| Ascaris suum | Query 166 DEHGEVCPAGWKPGGDTIKPNVEDSKEYF#SKN 197 |+||||||||| || ||||| |++|| ||# |+ Sbjct 164 DKHGEVCPAGWTPGADTIKPGVKESKAYF#EKH 195 |
| Caenorhabditis elegans | Query 166 DEHGEVCPAGWKPGGDTIKPNVEDSKEYF#SKN 197 ++||||||||| || ||||| |++|+|||# |+ Sbjct 164 EKHGEVCPAGWTPGSDTIKPGVKESQEYF#KKH 195 |
| Onchocerca volvulus | Query 166 DEHGEVCPAGWKPGGDTIKPNVEDSKEYF#SKN 197 | ||||||| |+|| +|||| |++|||||# |+ Sbjct 168 DNHGEVCPANWQPGSETIKPEVKESKEYF#GKH 199 |
| Onchocerca ochengi | Query 166 DEHGEVCPAGWKPGGDTIKPNVEDSKEYF#SKN 197 | ||||||| |+|| +|||| |++|||||# |+ Sbjct 168 DNHGEVCPANWQPGSETIKPEVKESKEYF#GKH 199 |
| Caenorhabditis briggsae | Query 166 DEHGEVCPAGWKPGGDTIKPNVEDSKEYF#SKN 197 ++||||||||| || |||||+|+ |+|||# |+ Sbjct 544 EKHGEVCPAGWTPGSDTIKPDVKKSQEYF#GKH 575 |
| Bombyx mori | Query 166 DEHGEVCPAGWKP--GGDTIKPNVEDSKEYF#SKNN 198 |+||||||||| | |||||| +||||||# | | Sbjct 193 DKHGEVCPAGWNPDTNADTIKPNPKDSKEYF#QKAN 227 |
| Apis mellifera | Query 165 TDEHGEVCPAGWKPGGDTIKPNVEDSKEYF# 194 ||+|||||||||||| |+||+| |||||# Sbjct 162 TDKHGEVCPAGWKPGKKTMKPDVVGSKEYF# 191 |
| Artemia franciscana | Query 165 TDEHGEVCPAGWKPGGDTIKPNVEDSKEYF#SKNN 198 ||+|||||||||||| ||| |+ | +||# | | Sbjct 210 TDKHGEVCPAGWKPGSDTIVPHPTDKLKYF#GKLN 243 |
| Debaryomyces hansenii CBS767 | Query 165 TDEHGEVCPAGWKPGGDTIKPNVEDSKEYF#SKNN 198 |+++|||||| |+|| +|||| | |||||# | | Sbjct 162 TEKYGEVCPANWQPGSETIKPEVSSSKEYF#GKVN 195 |
| Pichia guilliermondii ATCC 6260 | Query 165 TDEHGEVCPAGWKPGGDTIKPNVEDSKEYF#SKNN 198 |+++|||||| |+|| +|||| |+ +||||# | | Sbjct 162 TEKYGEVCPANWQPGSETIKPGVDSAKEYF#GKVN 195 |
| Pichia stipitis CBS 6054 | Query 165 TDEHGEVCPAGWKPGGDTIKPNVEDSKEYF#SKNN 198 |+++|||||| | || +|||| | |||||# | | Sbjct 162 TEKYGEVCPANWTPGAETIKPEVSSSKEYF#GKVN 195 |
| Tribolium castaneum | Query 165 TDEHGEVCPAGWKPGGDTIKPNVEDSKEYF#SKNN 198 |||||||||||| || |+|| | ||++|# + | Sbjct 163 TDEHGEVCPAGWTPGKKTMKPEVNASKDFF#EEVN 196 |
| Amoeba proteus | Query 165 TDEHGEVCPAGWKPGGDTIKPNVEDSKEYF#SK 196 ||+||||||| |+|| ||||| | |||#|+ Sbjct 141 TDKHGEVCPASWRPGAATIKPNPVDKLEYF#SQ 172 |
| Biomphalaria glabrata | Query 165 TDEHGEVCPAGWKPGGDTIKPNVEDSKEYF#SKNN 198 ||+|||||||||||| || |+ + |||||# + + Sbjct 186 TDKHGEVCPAGWKPGSATIIPDPKKSKEYF#KQQS 219 |
| Lodderomyces elongisporus NRRL YB-4239 | Query 165 TDEHGEVCPAGWKPGGDTIKPNVEDSKEYF#SKNN 198 |+++|||||| |+|| +||| ||||||#|| | Sbjct 162 TEKYGEVCPANWQPGSETIKATPNDSKEYF#SKVN 195 |
| Candida albicans SC5314 | Query 165 TDEHGEVCPAGWKPGGDTIKPNVEDSKEYF#SKNN 198 |+++|||||| | || +||||+ | |||||#+| | Sbjct 162 TEKYGEVCPANWHPGDETIKPSPEASKEYF#NKVN 195 |
| Dirofilaria immitis | Query 166 DEHGEVCPAGWKPGGDTIKPNVEDSKEYF#SKN 197 | ||||||| |+|| + ||| |++|| ||# |+ Sbjct 168 DNHGEVCPANWQPGSEAIKPGVKESKAYF#EKH 199 |
| Trypanosoma cruzi strain CL Brener | Query 166 DEHGEVCPAGWKPGGDTIKPNVEDSKEYF# 194 +|||||||| |||| |+||+ | |||||# Sbjct 167 EEHGEVCPANWKPGDKTMKPDPEKSKEYF# 195 |
| Schistosoma japonicum | Query 165 TDEHGEVCPAGWKPGGDTIKPNVEDSKEYF#SK 196 ||+||||||| |+| | ||||+++ ||||# | Sbjct 187 TDKHGEVCPADWQPKGPTIKPDLKQYKEYF#HK 218 |
| Acanthocheilonema viteae | Query 166 DEHGEVCPAGWKPGGDTIKPNVEDSKEYF# 194 |+||||||| | || +|||| |++|| ||# Sbjct 168 DKHGEVCPANWHPGSETIKPGVKESKAYF# 196 |
| Globodera rostochiensis | Query 165 TDEHGEVCPAGWKPGGDTIKPNVEDSKEYF#SK 196 || ||||||| |+|| |||||+ | |+ +|# | Sbjct 166 TDTHGEVCPANWQPGEDTIKPDPEGSQTFF#GK 197 |
| Apis mellifera ligustica | Query 166 DEHGEVCPAGWKPGGDTIKPNVEDSKEYF#SKNN 198 ++||||||| |+| ||||| +|||+||# | Sbjct 210 EKHGEVCPANWQPDSKTIKPNPKDSKQYF#ESVN 242 |
| Schistosoma mansoni | Query 165 TDEHGEVCPAGWKPGGDTIKPNVEDSKEYF#SKNN 198 ||++|||||| |+| | ||||+++ ||||# | | Sbjct 186 TDKYGEVCPADWQPKGPTIKPDLKKYKEYF#HKVN 219 |
| Glossina morsitans morsitans | Query 166 DEHGEVCPAGWKP--GGDTIKPNVEDSKEYF#SKN 197 ||||||||| | | |||||+| +||||#+|+ Sbjct 202 DEHGEVCPANWNPKTNPDTIKPDVNKAKEYF#NKH 235 |
| Yarrowia lipolytica | Query 165 TDEHGEVCPAGWKPGGDTIKPNVEDSKEYF#SKNN 198 |++||||||| |+ | |||| + ++||||# | | Sbjct 162 TEKHGEVCPANWQKGSDTIKADPVNAKEYF#EKAN 195 |
| Paramecium tetraurelia | Query 166 DEHGEVCPAGWKPGGDTIKPNVEDSKEYF#SKNN 198 ++||||||| |||| ||||++| || |+# + Sbjct 166 EKHGEVCPASWKPGQATIKPDIEKSKTYW#QNTH 198 |
| Candida glabrata | Query 165 TDEHGEVCPAGWKPGGDTIKPNVEDSKEYF#SKNN 198 ||++| | | | || |||| ||||||||# + | Sbjct 162 TDKNGTVLPCNWTPGSATIKPTVEDSKEYF#KEAN 195 |
| Trypanosoma cruzi | Query 166 DEHGEVCPAGWKPGGDTIKPNVEDSKEYF# 194 ++||||||| |||| +||+ | |||||# Sbjct 167 EKHGEVCPANWKPGDKAMKPDPEKSKEYF# 195 |
| Nitrosococcus oceani ATCC 19707 | Query 165 TDEHGEVCPAGWKPGGDTIKPNVEDSKEYF#SKN 197 |+||||||||||+ | + |+|+ | || #||+ Sbjct 163 TEEHGEVCPAGWRKGEEAIRPDAEGVAEYL#SKH 195 |
| Pongo pygmaeus | Query 166 DEHGEVCPAGWKPGGDTIKPNVEDSKEYF#SKNN 198 + ||||||| | | ||||| |||||# | | Sbjct 223 ETHGEVCPANWTPDSPTIKPNPAASKEYF#QKVN 255 |
| Saccharomyces cerevisiae | Query 165 TDEHGEVCPAGWKPGGDTIKPNVEDSKEYF#SKNN 198 ||++| | | | || |||| ||||||||# | Sbjct 162 TDKNGTVLPCNWTPGAATIKPTVEDSKEYF#EAAN 195 |
| Taiwanofungus camphoratus | Query 165 TDEHGEVCPAGWKPGGDTIKPNVEDSKEYF#S 195 |||||||||| | || ||| + + | |||#| Sbjct 163 TDEHGEVCPANWTEGGKTIKADPKGSLEYF#S 193 |
| Toxoptera citricida | Query 165 TDEHGEVCPAGWKPGGDTIKPNVEDSKEYF# 194 |||||||||| |||| || |+ ||+||# Sbjct 162 TDEHGEVCPANWKPGSKTINPS--KSKDYF# 189 |
| Gibberella zeae PH-1 | Query 165 TDEHGEVCPAGWKPGGDTIKPNVEDSKEYF#S 195 |||+||||||||+ || |+| + + | |||#| Sbjct 165 TDEYGEVCPAGWQEGGKTMKADPKGSLEYF#S 195 |
| Entamoeba moshkovskii | Query 165 TDEHGEVCPAGWKPGGDTIKPNVEDSKEYF#SKN 197 ||+|| ||| |||| |||+|+ + |+| #| + Sbjct 185 TDQHGAVCPLNWKPGNDTIEPSHDGIKKYL#SSH 217 |
| Fasciola hepatica | Query 166 DEHGEVCPAGWKPGGDTIKPNVEDSKEYF#SKNN 198 +|||||||| ||| || | + || ||#| | Sbjct 162 EEHGEVCPANWKPKSKTIVPTPDGSKAYF#SSAN 194 |
| Phaeosphaeria nodorum SN15 | Query 165 TDEHGEVCPAGWKPGGDTIKPNVEDSKEYF#SK 196 ||++|||||| | || +||| | +||| # | Sbjct 171 TDKYGEVCPANWNPGDETIKATPEGNKEYL#GK 202 |
| Taenia solium | Query 165 TDEHGEVCPAGWKPGGDTIKPNVEDSKEYF#S 195 ||+||||||| |+|| ||| | | + #| Sbjct 165 TDKHGEVCPANWRPGSKAFKPNAGDLKSFM#S 195 |
| Echinococcus granulosus | Query 165 TDEHGEVCPAGWKPGGDTIKPNVEDSKEYF#S 195 ||+||||||| |+|| | ||+ | | + #| Sbjct 162 TDKHGEVCPANWQPGSKTFKPSAGDLKSFM#S 192 |
| Litomosoides sigmodontis | Query 166 DEHGEVCPAGWKPGGDTIKPNVEDSK 191 |+|||+||| |+|| +|||| |++|| Sbjct 168 DKHGELCPANWQPGSETIKPGVKESK 193 |
| Ostreococcus tauri | Query 165 TDEHGEVCPAGWKPGGDTIKPNVEDSKEYF# 194 | |||||||||| || |+ + | |||||# Sbjct 19 TKEHGEVCPAGWTPGDPTMVGDPEKSKEYF# 48 |
| Brugia malayi | Query 166 DEHGEVCPAGWKPGGDTIKPNVEDSKEYF#SK 196 ++||||||| | |||| +++|||||# | Sbjct 194 EKHGEVCPANWSDDKPTIKPGIKESKEYF#KK 224 |
| Chlamydomonas reinhardtii | Query 170 EVCPAGWKPGGDTIKPNVEDSKEYF#S 195 |||||||||| |+||+ + |||||#| Sbjct 172 EVCPAGWKPGDKTMKPDPKGSKEYF#S 197 |
| Trypanosoma brucei TREU927 | Query 166 DEHGEVCPAGWKPGGDTIKPNVEDSKEYF#SKNN 198 ++||||||| |||| |+| + |++||#| | Sbjct 167 EKHGEVCPANWKPGSKTMKADPNGSQDYF#SSMN 199 |
| Oryza sativa (japonica cultivar-group) | Query 170 EVCPAGWKPGGDTIKPNVEDSKEYF#S 195 |||||||||| ++||+ +||||||#+ Sbjct 140 EVCPAGWKPGEKSMKPDPKDSKEYF#A 165 |
| Oryza sativa (indica cultivar-group) | Query 170 EVCPAGWKPGGDTIKPNVEDSKEYF#S 195 |||||||||| ++||+ +||||||#+ Sbjct 136 EVCPAGWKPGEKSMKPDPKDSKEYF#A 161 |
| Echinococcus multilocularis | Query 165 TDEHGEVCPAGWKPGGDTIKPNVEDSKEYF#S 195 ||+||||||| | || | ||+ | | + #| Sbjct 162 TDKHGEVCPANWHPGSKTFKPSAGDLKSFM#S 192 |
| Moniliophthora perniciosa | Query 165 TDEHGEVCPAGWKPGGDTIKPNVEDSKEYF# 194 ||+||||||| | || ||| + + | |||# Sbjct 163 TDKHGEVCPANWSEGGKTIKADPKSSLEYF# 192 |
| Trichomonas vaginalis G3 | Query 167 EHGEVCPAGWKPGGD-TIKPNVEDSKEYF#SKNN 198 +||||||| | || ||||| + |||||# | | Sbjct 163 KHGEVCPAQWHGEGDLTIKPNPKASKEYF#GKAN 195 |
| Maconellicoccus hirsutus | Query 165 TDEHGEVCPAGWKPGGDTIKPNVEDSKEYF# 194 ||+||||||| |||| ++| + + ++|||# Sbjct 162 TDKHGEVCPANWKPGSKSMKADPKGAQEYF# 191 |
| Kluyveromyces lactis | Query 165 TDEHGEVCPAGWKPGGDTIKPNVEDSKEYF#SKNN 198 ||++| | | | || |||| |+ |||||#| | Sbjct 162 TDKNGTVLPCNWTPGAATIKPEVDASKEYF#SSVN 195 |
| Campylobacter curvus 525.92 | Query 165 TDEHGEVCPAGWKPGGDTIKPNVEDSKEYF#SKN 197 |+|||||||||| | + +||+ | +| #| | Sbjct 163 TNEHGEVCPAGWHKGDEGMKPSTEGVADYL#SHN 195 |
| Chlamydomonas incerta | Query 170 EVCPAGWKPGGDTIKPNVEDSKEYF#S 195 |||||||||| |+||+ + |||||#+ Sbjct 208 EVCPAGWKPGDKTMKPDPKGSKEYF#A 233 |
| Riccia fluitans | Query 170 EVCPAGWKPGGDTIKPNVEDSKEYF#SK 196 |||||||||| |+||+ + |||||#++ Sbjct 248 EVCPAGWKPGEKTMKPDTKLSKEYF#AQ 274 |
| Ostreococcus lucimarinus CCE9901 | Query 165 TDEHGEVCPAGWKPGGDTIKPNVEDSKEYF#SK 196 | |||||||||| || |+ + | || ||# + Sbjct 161 TAEHGEVCPAGWTPGAPTMIDDPEKSKTYF#EQ 192 |
| Entamoeba histolytica HM-1:IMSS | Query 165 TDEHGEVCPAGWKPGGDTIKPNVEDSKEYF#S 195 +|||| ||| |||| |||+| + |+| #+ Sbjct 197 SDEHGAVCPLNWKPGKDTIEPTPDGIKKYL#T 227 |
| Entamoeba histolytica | Query 165 TDEHGEVCPAGWKPGGDTIKPNVEDSKEYF#S 195 +|||| ||| |||| |||+| + |+| #+ Sbjct 177 SDEHGAVCPLNWKPGKDTIEPTSDGIKKYL#T 207 |
| Nicotiana tabacum | Query 166 DEHGEVCPAGWKPGGDTIKPNVEDSKEYF#S 195 | |||||||||| ++||+ + |||||#+ Sbjct 240 DNPDEVCPAGWKPGEKSMKPDPKGSKEYF#A 269 |
| Tetrahymena thermophila SB210 | Query 165 TDEHGEVCPAGWKPGGDTIKPN--VEDSKEYF#SK 196 |||||||||| |+||| + || | ||++# | Sbjct 188 TDEHGEVCPAKWRPGGKGMVPNHQSEKLKEFW#EK 221 |
* References
None.